• Gene id: 10131

Gene Summary

• Gene Symbol: TRAP1   Gene   UCSC   Ensembl
• Aliases: HSP 75, HSP75, HSP90L, TRAP-1
• Gene name: TNF receptor associated protein 1
• Alternate names: heat shock protein 75 kDa, mitochondrial, TNFR-associated protein 1, testicular tissue protein Li 209, tumor necrosis factor type 1 receptor-associated protein,
• Gene location: 16p13.3 (3717523: 3658036)     Exons: 19     NC_000016.10
• Gene summary(Entrez): This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stres
• OMIM: 606446

Protein Summary

• Protein general information: Q12931  
  • Name: Heat shock protein 75 kDa, mitochondrial (HSP 75) (TNFR associated protein 1) (Tumor necrosis factor type 1 receptor associated protein) (TRAP 1)
  • Length: 704  
  • Mass: 80110
  • Tissue specificity: Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung, placenta and bladder. Expression is highly reduced in bladder cancer and renal cell carcinoma specimens compared to healthy tissues, but it is increased in other ty
• Sequence:

  MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSII
  SSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAE
  KGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPG
  SLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
  MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTK
  ATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMRE
  GIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVL
  FCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
  LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYEN
  AMIAAGLVDDPRAMVGRLNELLVKALERH

• Structural information:
  • Interpro: IPR003594  IPR036890  IPR037196  IPR001404  IPR020575   IPR020568  
  • PDB: 4Z1F 4Z1G 4Z1H 4Z1I 5F3K 5F5R 5HPH 5Y3N 5Y3O
  • PDBsum: 4Z1F 4Z1G 4Z1H 4Z1I 5F3K 5F5R 5HPH 5Y3N 5Y3O
  • DIP: 6250
  • STRING: ENSP00000246957
• Other Databases: GeneCards:  TRAP1  Malacards:  TRAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005164	tumor necrosis factor receptor binding	NAS	molecular function
GO:1903427	negative regulation of reactive oxygen species biosynthetic process	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:1903751	negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	ISS	biological process
GO:0061077	chaperone-mediated protein folding	TAS	biological process
GO:0005758	mitochondrial intermembrane space	ISS	cellular component
GO:0009386	translational attenuation	IMP	biological process
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903751	negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:1901856	negative regulation of cellular respiration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005164	tumor necrosis factor receptor binding	NAS	molecular function
GO:1903427	negative regulation of reactive oxygen species biosynthetic process	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:1903751	negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	ISS	biological process
GO:0061077	chaperone-mediated protein folding	TAS	biological process
GO:0005758	mitochondrial intermembrane space	ISS	cellular component
GO:0009386	translational attenuation	IMP	biological process
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903751	negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:1901856	negative regulation of cellular respiration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq