• Gene id: 10126

Gene Summary

• Gene Symbol: DNAL4   Gene   UCSC   Ensembl
• Aliases: MRMV3, PIG27
• Gene name: dynein axonemal light chain 4
• Alternate names: dynein light chain 4, axonemal, dynein light chain, outer arm 4, dynein, axonemal, light polypeptide 4, proliferation-inducing gene 27, proliferation-inducing protein 27,
• Gene location: 22q13.1 (38794142: 38778507)     Exons: 4     NC_000022.11
• Gene summary(Entrez): This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed i
• OMIM: 610565

Protein Summary

• Protein general information: O96015  
  • Name: Dynein light chain 4, axonemal
  • Length: 105  
  • Mass: 12009
• Sequence:

  MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGE
  GFGFEITHEVKNLLYLYFGGTLAVCVWKCS

• Structural information:
  • Interpro: IPR037177  IPR001372  
  • STRING: ENSP00000216068
• Other Databases: GeneCards:  DNAL4  Malacards:  DNAL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030286	dynein complex	IBA	cellular component
GO:0045505	dynein intermediate chain binding	IBA	molecular function
GO:0051959	dynein light intermediate chain binding	IBA	molecular function
GO:2000582	positive regulation of ATP-dependent microtubule motor activity, plus-end-directed	IBA	biological process
GO:0007017	microtubule-based process	IEA	biological process
GO:0030286	dynein complex	IEA	cellular component
GO:0030286	dynein complex	IEA	cellular component
GO:0003774	motor activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0003777	microtubule motor activity	TAS	molecular function
GO:0007018	microtubule-based movement	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease

Diseases

Associated diseases	References
Congenital mirror movements	KEGG:H01287
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R