• Gene id: 10123

Gene Summary

• Gene Symbol: ARL4C   Gene   UCSC   Ensembl
• Aliases: ARL7, LAK
• Gene name: ADP ribosylation factor like GTPase 4C
• Alternate names: ADP-ribosylation factor-like protein 4C, ADP ribosylation factor-like protein 7, ADP-ribosylation factor-like 4C, ADP-ribosylation factor-like 7, ADP-ribosylation factor-like protein LAK,
• Gene location: 2q37.1 (234497080: 234493040)     Exons: 1     NC_000002.12
• Gene summary(Entrez): ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This
• OMIM: 604787

Protein Summary

• Protein general information: P56559  
  • Name: ADP ribosylation factor like protein 4C (ADP ribosylation factor like protein 7) (ADP ribosylation factor like protein LAK)
  • Length: 192  
  • Mass: 21487
  • Tissue specificity: Expressed in several tumor cell lines (at protein level). Expressed in lung, brain, leukocytes and placenta. {ECO
• Sequence:

  MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKL
  RPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELI
  PATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • STRING: ENSP00000339754
• Other Databases: GeneCards:  ARL4C  Malacards:  ARL4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IBA	molecular function
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0032456	endocytic recycling	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0032456	endocytic recycling	IDA	biological process
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881