• Gene id: 10121

Gene Summary

• Gene Symbol: ACTR1A   Gene   UCSC   Ensembl
• Aliases: ARP1, Arp1A, CTRN1
• Gene name: actin related protein 1A
• Alternate names: alpha-centractin, ARP1 actin related protein 1 homolog A, ARP1 actin-related protein 1 homolog A, centractin alpha, actin-RPV, centractin, centrosome-associated actin homolog, epididymis secretory sperm binding protein,
• Gene location: 10q24.32 (102502711: 102479228)     Exons: 11     NC_000010.11
• Gene summary(Entrez): This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions,
• OMIM: 605143

Protein Summary

• Protein general information: P61163  
  • Name: Alpha centractin (Centractin) (ARP1) (Actin RPV) (Centrosome associated actin homolog)
  • Length: 376  
  • Mass: 42614
• Sequence:

  MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPM
  EHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYAT
  GRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLS
  INPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
  SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT
  F

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR004001  
  • Prosite: PS00432 PS01132
  • STRING: ENSP00000358921
• Other Databases: GeneCards:  ACTR1A  Malacards:  ACTR1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000132	establishment of mitotic spindle orientation	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0005869	dynactin complex	IBA	cellular component
GO:0030473	nuclear migration along microtubule	IBA	biological process
GO:0099738	cell cortex region	IBA	cellular component
GO:0106006	cytoskeletal protein-membrane anchor activity	IBA	contributes to
GO:0005813	centrosome	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0005869	dynactin complex	TAS	cellular component
GO:0016192	vesicle-mediated transport	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0002177	manchette	IEA	cellular component
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease

Diseases

Associated diseases	References
Down syndrome	PMID:11829462
colon cancer	PMID:26422100
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray