• Gene id: 10120

Gene Summary

• Gene Symbol: ACTR1B   Gene   UCSC   Ensembl
• Aliases: ARP1B, CTRN2, PC3
• Gene name: actin related protein 1B
• Alternate names: beta-centractin, ARP1 actin related protein 1 homolog B, ARP1 actin-related protein 1 homolog B, centractin beta, centractin beta,
• Gene location: 2q11.2 (97664043: 97655938)     Exons: 12     NC_000002.12
• Gene summary(Entrez): This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, inc

Protein Summary

• Protein general information: P42025  
  • Name: Beta centractin (Actin related protein 1B) (ARP1B)
  • Length: 376  
  • Mass: 42293
• Sequence:

  MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPM
  EHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYAT
  GRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLS
  INPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL
  SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKT
  F

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR004001  
  • Prosite: PS00432 PS01132
  • STRING: ENSP00000289228
• Other Databases: GeneCards:  ACTR1B  Malacards:  ACTR1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0106006	cytoskeletal protein-membrane anchor activity	IBA	contributes to
GO:0099738	cell cortex region	IBA	cellular component
GO:0030473	nuclear migration along microtubule	IBA	biological process
GO:0005869	dynactin complex	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005869	dynactin complex	TAS	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R