• Gene id: 1012

Gene Summary

• Gene Symbol: CDH13   Gene   UCSC   Ensembl
• Aliases: CDHH, P105
• Gene name: cadherin 13
• Alternate names: cadherin-13, H-cadherin (heart), T-cad, T-cadherin, cadherin 13, H-cadherin (heart), heart cadherin,
• Gene location: 16q23.3 (82626822: 83800639)     Exons: 20     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of
• OMIM: 607048

Protein Summary

• Protein general information: P55290  
  • Name: Cadherin 13 (Heart cadherin) (H cadherin) (P105) (Truncated cadherin) (T cad) (T cadherin)
  • Length: 713  
  • Mass: 78287
  • Tissue specificity: Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord. {ECO
• Sequence:

  MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSSPYFKV
  NSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSIVVSPILIPEN
  QRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTL
  EGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
  IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVEEG
  AVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPL
  VPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLN
  INPINGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLS
  VVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDL
  RVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL

• Structural information:
  • Protein Domains: (139..24-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (246..36-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (364..47-)
    (/note="Cadherin-3)
    (/evidence="ECO:0000255|PROSITE-ProRule-)
  • Interpro: IPR039808  IPR002126  IPR015919  IPR020894  IPR014868   IPR033216  
  • Prosite: PS00232 PS50268
  • PDB: 2V37
  • PDBsum: 2V37
  • STRING: ENSP00000268613
• Other Databases: GeneCards:  CDH13  Malacards:  CDH13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0016342	catenin complex	IBA	cellular component
GO:0007043	cell-cell junction assembly	IBA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0034332	adherens junction organization	IBA	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	IBA	biological process
GO:0045296	cadherin binding	IBA	molecular function
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	IBA	biological process
GO:0000902	cell morphogenesis	IBA	biological process
GO:0002040	sprouting angiogenesis	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005912	adherens junction	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0055100	adiponectin binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0010033	response to organic substance	IEA	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045296	cadherin binding	IDA	molecular function
GO:0055100	adiponectin binding	ISS	molecular function
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0002040	sprouting angiogenesis	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0030032	lamellipodium assembly	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0043005	neuron projection	IDA	cellular component
GO:0043542	endothelial cell migration	IDA	biological process
GO:0043616	keratinocyte proliferation	IDA	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IDA	biological process
GO:0050927	positive regulation of positive chemotaxis	IDA	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IMP	biological process
GO:0007266	Rho protein signal transduction	IMP	biological process
GO:0016601	Rac protein signal transduction	IMP	biological process
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0051668	localization within membrane	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IDA	biological process
GO:0007162	negative regulation of cell adhesion	IDA	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	biological process
GO:0055096	low-density lipoprotein particle mediated signaling	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0030100	regulation of endocytosis	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0071813	lipoprotein particle binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

Diseases

Associated diseases	References
Prostate cancer	PMID:18387661
urinary bladder cancer	PMID:18094410
Breast cancer	PMID:8673923
Breast cancer	PMID:17764565
Arteriosclerosis	PMID:11326751
Ovarian cancer	PMID:10493953
Ovarian cancer	PMID:10493953
Endometrial carcinoma	PMID:18519763
Breast carcinoma	PMID:11389090
lung non-small cell carcinoma	PMID:11389090
cervical cancer	PMID:17548682
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray