• Gene id: 101180976

Gene Summary

• Gene Symbol: IFNL4   Gene   UCSC   Ensembl
• Aliases: IFNAN
• Gene name: interferon lambda 4 (gene/pseudogene)
• Alternate names: interferon lambda-4, IFN-lambda-4, interferon, lambda 4,
• Gene location: 19q13.2 (39248855: 39246313)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene is a polymorphic pseudogene which, in some humans, encodes the interferon (IFN) lambda 4 protein. Humans are polymorphic for the dinucleotide TT/deltaG allele. Compared to the ancestral state in non-human primates, the TT allele produces a frame
• OMIM: 603970

Protein Summary

• Protein general information: K9M1U5  
  • Name: Interferon lambda 4 (IFN lambda 4)
  • Length: 179  
  • Mass: 19675
• Sequence:

  MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSS
  CARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSP
  RCRKASVVFNLLRLLTWELRLAAHSGPCL

• Structural information:
  • Interpro: IPR038326  IPR029177  
• Other Databases: GeneCards:  IFNL4  Malacards:  IFNL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051607	defense response to virus	IMP	biological process
GO:0007260	tyrosine phosphorylation of STAT protein	IMP	biological process
GO:0005125	cytokine activity	IMP	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0050778	positive regulation of immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryoglobulinemia	PMID:24293567
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray