• Gene id: 10116

Gene Summary

• Gene Symbol: FEM1B   Gene   UCSC   Ensembl
• Aliases: F1A-ALPHA, F1AA, FEM1-beta
• Gene name: fem-1 homolog B
• Alternate names: protein fem-1 homolog B, FEM-1-like death receptor binding protein, fem-1-like death receptor-binding protein alpha, fem-1-like in apoptotic pathway protein alpha,
• Gene location: 15q23 (68277744: 68295861)     Exons: 2     NC_000015.10
• Gene summary(Entrez): This gene encodes an ankyrin repeat protein that belongs to the death receptor-associated family of proteins and plays a role in mediating apoptosis. The encoded protein is also thought to function in the replication stress-induced checkpoint signaling pa
• OMIM: 613539

Protein Summary

• Protein general information: Q9UK73  
  • Name: Protein fem 1 homolog B (FEM1b) (FEM1 beta) (Fem 1 like death receptor binding protein alpha) (Fem 1 like in apoptotic pathway protein alpha) (F1A alpha)
  • Length: 627  
  • Mass: 70264
  • Tissue specificity: Widely expressed. Highly expressed in testis. Weakly expressed in other tissues. {ECO
• Sequence:

  MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQ
  TGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIA
  NKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKV
  AAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIH
  AYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQ
  KGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYL
  VCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEV
  NAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCL
  AARAVRANDINYQDQIPRTLEEFVGFH

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • DIP: 31663
  • STRING: ENSP00000307298
• Other Databases: GeneCards:  FEM1B  Malacards:  FEM1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:2000001	regulation of DNA damage checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060743	epithelial cell maturation involved in prostate gland development	IEA	biological process
GO:0002070	epithelial cell maturation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0060442	branching involved in prostate gland morphogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051438	regulation of ubiquitin-protein transferase activity	IMP	biological process
GO:0005123	death receptor binding	NAS	molecular function
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:0005123	death receptor binding	IMP	molecular function
GO:0006915	apoptotic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R