• Gene id: 10110

Gene Summary

• Gene Symbol: SGK2   Gene   UCSC   Ensembl
• Aliases: H-SGK2, dJ138B7.2
• Gene name: serum/glucocorticoid regulated kinase 2
• Alternate names: serine/threonine-protein kinase Sgk2, SGK2, serine/threonine kinase 2,
• Gene location: 20q13.12 (136546047: 136494432)     Exons: 34     NC_000009.12
• Gene summary(Entrez): This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that ac
• OMIM: 607589

Protein Summary

• Protein general information: Q9HBY8  
  • Name: Serine/threonine protein kinase Sgk2 (EC 2.7.11.1) (Serum/glucocorticoid regulated kinase 2)
  • Length: 427  
  • Mass: 47604
  • Tissue specificity: Highly expressed in liver, kidney and pancreas, and at lower levels in brain. {ECO
• Sequence:

  MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYRMNSSPAGTPSPQPSR
  ANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKN
  VRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENI
  LLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
  QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTG
  PADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

• Structural information:
  • Protein Domains: (95..35-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (353..42-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • STRING: ENSP00000340608
• Other Databases: GeneCards:  SGK2  Malacards:  SGK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006979	response to oxidative stress	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0017080	sodium channel regulator activity	NAS	molecular function
GO:0006468	protein phosphorylation	NAS	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0015459	potassium channel regulator activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0042127	regulation of cell population proliferation	TAS	biological process
GO:0001558	regulation of cell growth	TAS	biological process
GO:0032411	positive regulation of transporter activity	TAS	biological process
GO:0017080	sodium channel regulator activity	TAS	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq