• Gene id: 10106

Gene Summary

• Gene Symbol: CTDSP2   Gene   UCSC   Ensembl
• Aliases: OS4, PSR2, SCP2
• Gene name: CTD small phosphatase 2
• Alternate names: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2, NLI-interacting factor 2, conserved gene amplified in osteosarcoma, nuclear LIM interactor-intera,
• Gene location: 12q14.1 (57846728: 57816701)     Exons: 8     NC_000012.12
• OMIM: 608711

Protein Summary

• Protein general information: O14595  
  • Name: Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 2 (EC 3.1.3.16) (Nuclear LIM interactor interacting factor 2) (NLI interacting factor 2) (Protein OS 4) (Small C terminal domain phosphatase 2) (Small CTD phosphatase 2) (SCP2)
  • Length: 271  
  • Mass: 30664
  • Tissue specificity: Expression is restricted to non-neuronal tissues. Highest expression in pancreas and lowest in liver. {ECO
• Sequence:

  MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLL
  QCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFL
  RRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIF
  HPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP

• Structural information:
  • Protein Domains: (97..25-)
    (/note="FCP1-homology)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00336"-)
  • Interpro: IPR011948  IPR004274  IPR036412  IPR023214  IPR040078  
  • Prosite: PS50969
  • PDB: 2Q5E
  • PDBsum: 2Q5E
  • DIP: 61245
  • STRING: ENSP00000381148
• Other Databases: GeneCards:  CTDSP2  Malacards:  CTDSP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IBA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray