• Gene id: 10105

Gene Summary

• Gene Symbol: PPIF   Gene   UCSC   Ensembl
• Aliases: CYP3, CyP-M, Cyp-D, CypD
• Gene name: peptidylprolyl isomerase F
• Alternate names: peptidyl-prolyl cis-trans isomerase F, mitochondrial, PPIase F, cyclophilin 3, cyclophilin D, cyclophilin F, mitochondrial cyclophilin, peptidyl-prolyl cis-trans isomerase, mitochondrial, rotamase F,
• Gene location: 10q22.3 (79347468: 79355333)     Exons: 5     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is
• OMIM: 604486

SNPs

rs1042838

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.101062681C>A
NC_000011.10   g.101062681C>G
NC_000011.9   g.100933412C>A
NC_000011.9   g.100933412C>G
NG_016475.1   g.72133G>T
NG_016475.1   g.72133G>C
NM_000926.4   c.1978G>T
NM_000926.4   c.1978G>C
NM_001202474.3   c.1486G>T
NM_001202474.3   c.1486G>C
  

Protein Summary

• Protein general information: P30405  
  • Name: Peptidyl prolyl cis trans isomerase F, mitochondrial (PPIase F) (EC 5.2.1.8) (Cyclophilin D) (CyP D) (CypD) (Cyclophilin F) (Mitochondrial cyclophilin) (CyP M) (Rotamase F)
  • Length: 207  
  • Mass: 22040
• Sequence:

  MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTA
  ENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTN
  GSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

• Structural information:
  • Protein Domains: (49..20-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156"-)
  • Interpro: IPR029000  IPR024936  IPR020892  IPR002130  
  • Prosite: PS00170 PS50072
  • PDB: 2BIT 2BIU 2Z6W 3QYU 3R49 3R4G 3R54 3R56 3R57 3R59 3RCF 3RCG 3RCI 3RCK 3RCL 3RD9 3RDA 3RDB 3RDC 4J58 4J59 4J5A 4J5B 4J5C 4J5D 4J5E 4O8H 4O8I 4XNC 4ZSC 4ZSD 5A0E 5CBT 5CBU 5CBV 5CBW 5CCN 5CCQ 5CCR 5CCS 5NWO 6GJX 6R8L 6R8O 6R8W 6R9S 6R9U 6R9X 6RA1
  • PDBsum: 2BIT 2BIU 2Z6W 3QYU 3R49 3R4G 3R54 3R56 3R57 3R59 3RCF 3RCG 3RCI 3RCK 3RCL 3RD9 3RDA 3RDB 3RDC 4J58 4J59 4J5A 4J5B 4J5C 4J5D 4J5E 4O8H 4O8I 4XNC 4ZSC 4ZSD 5A0E 5CBT 5CBU 5CBV 5CBW 5CCN 5CCQ 5CCR 5CCS 5NWO 6GJX 6R8L 6R8O 6R8W 6R9S 6R9U 6R9X 6RA1
  • STRING: ENSP00000225174
• Other Databases: GeneCards:  PPIF  Malacards:  PPIF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0016018	cyclosporin A binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0046902	regulation of mitochondrial membrane permeability	IBA	biological process
GO:0070301	cellular response to hydrogen peroxide	IBA	biological process
GO:1902445	regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IBA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005757	mitochondrial permeability transition pore complex	IDA	cellular component
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IDA	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0071277	cellular response to calcium ion	ISS	biological process
GO:0032780	negative regulation of ATPase activity	ISS	biological process
GO:0002931	response to ischemia	ISS	biological process
GO:2000276	negative regulation of oxidative phosphorylation uncoupler activity	ISS	biological process
GO:0090324	negative regulation of oxidative phosphorylation	ISS	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:0071243	cellular response to arsenic-containing substance	ISS	biological process
GO:0070301	cellular response to hydrogen peroxide	IMP	biological process
GO:0046902	regulation of mitochondrial membrane permeability	ISS	biological process
GO:0010849	regulation of proton-transporting ATPase activity, rotational mechanism	ISS	biological process
GO:0005753	mitochondrial proton-transporting ATP synthase complex	ISS	colocalizes with
GO:0046902	regulation of mitochondrial membrane permeability	IMP	biological process
GO:1902686	mitochondrial outer membrane permeabilization involved in programmed cell death	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0012501	programmed cell death	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016018	cyclosporin A binding	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0070266	necroptotic process	IEA	biological process
GO:0032780	negative regulation of ATPase activity	IEA	biological process
GO:0008637	apoptotic mitochondrial changes	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0042277	peptide binding	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:2000276	negative regulation of oxidative phosphorylation uncoupler activity	IEA	biological process
GO:1902445	regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IEA	biological process
GO:0090324	negative regulation of oxidative phosphorylation	IEA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IEA	biological process
GO:0071243	cellular response to arsenic-containing substance	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IEA	biological process
GO:0010939	regulation of necrotic cell death	IEA	biological process
GO:0010849	regulation of proton-transporting ATPase activity, rotational mechanism	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:1902445	regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)