• Gene id: 10103

Gene Summary

• Gene Symbol: TSPAN1   Gene   UCSC   Ensembl
• Aliases: NET1, TM4C, TM4SF
• Gene name: tetraspanin 1
• Alternate names: tetraspanin-1, tetraspan 1,
• Gene location: 1p34.1 (46175086: 46196488)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 613170

Protein Summary

• Protein general information: O60635  
  • Name: Tetraspanin 1 (Tspan 1) (Tetraspan NET 1) (Tetraspanin TM4 C)
  • Length: 241  
  • Mass: 26301
• Sequence:

  MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGC
  YGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCC
  GFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGL
  ELAAMIVSMYLYCNLQ

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000361072
• Other Databases: GeneCards:  TSPAN1  Malacards:  TSPAN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881