• Gene id: 10102

Gene Summary

• Gene Symbol: TSFM   Gene   UCSC   Ensembl
• Aliases: EFTS, EFTSMT
• Gene name: Ts translation elongation factor, mitochondrial
• Alternate names: elongation factor Ts, mitochondrial, EF-Ts, EF-TsMt, mitochondrial elongation factor Ts,
• Gene location: 12q14.1 (57782744: 57802855)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a mitochondrial translation elongation factor. The encoded protein is an enzyme that catalyzes the exchange of guanine nucleotides on the translation elongation factor Tu during the elongation step of mitchondrial protein translation. Mu
• OMIM: 604723

Protein Summary

• Protein general information: P43897  
  • Name: Elongation factor Ts, mitochondrial (EF Ts) (EF TsMt)
  • Length: 325  
  • Mass: 35391
  • Tissue specificity: Expressed in all tissues, with the highest levels of expression in skeletal muscle, liver and kidney.
• Sequence:

  MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDL
  KQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQ
  TLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPS
  LHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYV
  QPQGVSVVDFVRFECGEGEEAAETE

• Structural information:
  • Interpro: IPR036402  IPR001816  IPR014039  IPR018101  IPR009060  
  • Prosite: PS01126 PS01127
  • PDB: 2CP9
  • PDBsum: 2CP9
  • STRING: ENSP00000313877
• Other Databases: GeneCards:  TSFM  Malacards:  TSFM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006414	translational elongation	IBA	biological process
GO:0003746	translation elongation factor activity	IBA	molecular function
GO:0070125	mitochondrial translational elongation	IBA	biological process
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0070129	regulation of mitochondrial translation	IDA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0006414	translational elongation	IEA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0006414	translational elongation	TAS	biological process
GO:0032784	regulation of DNA-templated transcription, elongation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006414	translational elongation	IEA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Combined oxidative phosphorylation deficiency	KEGG:H00891
Combined oxidative phosphorylation deficiency	KEGG:H00891
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)