• Gene id: 10101

Gene Summary

• Gene Symbol: NUBP2   Gene   UCSC   Ensembl
• Aliases: CFD1, CIAO6, NBP 2, NUBP1
• Gene name: nucleotide binding protein 2
• Alternate names: cytosolic Fe-S cluster assembly factor NUBP2, homolog of yeast cytosolic Fe-S cluster deficient 1, nucleotide binding protein 2 (MinD homolog, E. coli),
• Gene location: 16p13.3 (1782959: 1789185)     Exons: 10     NC_000016.10
• Gene summary(Entrez): This gene encodes an adenosine triphosphate (ATP) and metal-binding protein that is required for the assembly of cyotosolic iron-sulfur proteins. The encoded protein functions in a heterotetramer with nucleotide-binding protein 1 (NUBP1). Alternative spli
• OMIM: 610779

Protein Summary

• Protein general information: Q9Y5Y2  
  • Name: Cytosolic Fe S cluster assembly factor NUBP2 (Nucleotide binding protein 2) (NBP 2)
  • Length: 271  
  • Mass: 28825
  • Tissue specificity: Widely expressed with highest expression in skeletal muscle.
• Sequence:

  MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRG
  WAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDEHMATIEALRP
  YQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGS
  VPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP

• Structural information:
  • Interpro: IPR019591  IPR000808  IPR028600  IPR027417  IPR033756  
  • Prosite: PS01215
  • STRING: ENSP00000262302
• Other Databases: GeneCards:  NUBP2  Malacards:  NUBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051536	iron-sulfur cluster binding	IBA	molecular function
GO:0016226	iron-sulfur cluster assembly	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0000166	nucleotide binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031616	spindle pole centrosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)