• Gene id: 10098

Gene Summary

• Gene Symbol: TSPAN5   Gene   UCSC   Ensembl
• Aliases: NET-4, NET4, TM4SF9, TSPAN-5
• Gene name: tetraspanin 5
• Alternate names: tetraspanin-5, tetraspan NET-4, tetraspan TM4SF, transmembrane 4 superfamily member 9, transmembrane 4 superfamily, member 8,
• Gene location: 4q23 (98658660: 98470366)     Exons: 8     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 603190

Protein Summary

• Protein general information: P62079  
  • Name: Tetraspanin 5 (Tspan 5) (Tetraspan NET 4) (Transmembrane 4 superfamily member 9)
  • Length: 268  
  • Mass: 30337
• Sequence:

  MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFIL
  GFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY
  WQCCGAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQF
  EKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000307701
• Other Databases: GeneCards:  TSPAN5  Malacards:  TSPAN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051604	protein maturation	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0051604	protein maturation	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray