• Gene id: 10097

Gene Summary

• Gene Symbol: ACTR2   Gene   UCSC   Ensembl
• Aliases: ARP2
• Gene name: actin related protein 2
• Alternate names: actin-related protein 2, ARP2 actin related protein 2 homolog, actin-like protein 2,
• Gene location: 2p14 (65227694: 65271252)     Exons: 10     NC_000002.12
• Gene summary(Entrez): The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamel
• OMIM: 604221

Protein Summary

• Protein general information: P61160  
  • Name: Actin related protein 2 (Actin like protein 2)
  • Length: 394  
  • Mass: 44761
• Sequence:

  MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPME
  NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQG
  LLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGY
  NIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
  IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTR
  QEYQEKGVRVLEKLGVTVR

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR027306  
  • Prosite: PS01132
  • DIP: 33165
  • STRING: ENSP00000367220
• Other Databases: GeneCards:  ACTR2  Malacards:  ACTR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005885	Arp2/3 protein complex	IBA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0051015	actin filament binding	IBA	contributes to
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:1905168	positive regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0010592	positive regulation of lamellipodium assembly	IDA	biological process
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	IDA	NOT|biological process
GO:0035861	site of double-strand break	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0051015	actin filament binding	IDA	contributes to
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0071437	invadopodium	IEA	cellular component
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0035984	cellular response to trichostatin A	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0016344	meiotic chromosome movement towards spindle pole	IEA	biological process
GO:0008356	asymmetric cell division	IEA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:0061825	podosome core	IEA	cellular component
GO:0035902	response to immobilization stress	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0008306	associative learning	IEA	biological process
GO:0051653	spindle localization	IEA	biological process
GO:0033206	meiotic cytokinesis	IEA	biological process
GO:0030478	actin cap	IEA	cellular component
GO:0016482	cytosolic transport	IEA	biological process
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0005885	Arp2/3 protein complex	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa05135	Yersinia infection

Diseases

Associated diseases	References
colorectal carcinoma	PMID:14990971
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R