• Gene id: 10096

Gene Summary

• Gene Symbol: ACTR3   Gene   UCSC   Ensembl
• Aliases: ARP3
• Gene name: actin related protein 3
• Alternate names: actin-related protein 3, ARP3 actin related protein 3 homolog, actin-like protein 3,
• Gene location: 2q14.1 (113889933: 113962595)     Exons: 13     NC_000002.12
• Gene summary(Entrez): The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamel
• OMIM: 604222

Protein Summary

• Protein general information: P61158  
  • Name: Actin related protein 3 (Actin like protein 3)
  • Length: 418  
  • Mass: 47371
• Sequence:

  MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATK
  WPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALA
  ASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAK
  AVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
  DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRY
  AVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR015623  
  • Prosite: PS01132
  • DIP: 33140
  • STRING: ENSP00000263238
• Other Databases: GeneCards:  ACTR3  Malacards:  ACTR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005885	Arp2/3 protein complex	IBA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0051015	actin filament binding	IBA	contributes to
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0010592	positive regulation of lamellipodium assembly	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0035861	site of double-strand break	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0051015	actin filament binding	IDA	contributes to
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0016344	meiotic chromosome movement towards spindle pole	IEA	biological process
GO:0008356	asymmetric cell division	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0051653	spindle localization	IEA	biological process
GO:0033206	meiotic cytokinesis	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0005903	brush border	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0070358	actin polymerization-dependent cell motility	TAS	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0005885	Arp2/3 protein complex	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa05135	Yersinia infection

Diseases

Associated diseases	References
colorectal carcinoma	PMID:14990971
Glioblastoma multiforme	PMID:25682201
gallbladder carcinoma	PMID:23320827
Schizophrenia	PMID:16491132
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq