• Gene id: 10095

Gene Summary

• Gene Symbol: ARPC1B   Gene   UCSC   Ensembl
• Aliases: ARC41, PLTEID, p40-ARC, p41-ARC
• Gene name: actin related protein 2/3 complex subunit 1B
• Alternate names: actin-related protein 2/3 complex subunit 1B, ARP2/3 protein complex subunit p41, actin related protein 2/3 complex, subunit 1B, 41kDa, arp2/3 complex 41 kDa subunit,
• Gene location: 7q22.1 (99374253: 99394815)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they bo
• OMIM: 606395

Protein Summary

• Protein general information: O15143  
  • Name: Actin related protein 2/3 complex subunit 1B (Arp2/3 complex 41 kDa subunit) (p41 ARC)
  • Length: 372  
  • Mass: 40950
• Sequence:

  MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRN
  AYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDW
  HPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDST
  VCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
  RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK

• Structural information:
  • Interpro: IPR030141  IPR017383  IPR015943  IPR001680  IPR017986   IPR036322  
  • Prosite: PS50082 PS50294
  • DIP: 41254
  • STRING: ENSP00000389631
• Other Databases: GeneCards:  ARPC1B  Malacards:  ARPC1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005885	Arp2/3 protein complex	IBA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005885	Arp2/3 protein complex	TAS	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0051015	actin filament binding	IDA	contributes to
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043627	response to estrogen	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0036284	tubulobulbar complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04666	Fc gamma R-mediated phagocytosis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
oral squamous cell carcinoma	PMID:26138391
Myelodysplastic syndrome	PMID:22608605
Stomach cancer	PMID:15279900
Schizophrenia	PMID:15098003
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq