• Gene id: 10094

Gene Summary

• Gene Symbol: ARPC3   Gene   UCSC   Ensembl
• Aliases: ARC21, p21-Arc
• Gene name: actin related protein 2/3 complex subunit 3
• Alternate names: actin-related protein 2/3 complex subunit 3, ARP2/3 protein complex subunit p21, actin related protein 2/3 complex, subunit 3, 21kDa, arp2/3 complex 21 kDa subunit,
• Gene location: 12q24.11 (110450410: 110434822)     Exons: 7     NC_000012.12
• Gene summary(Entrez): This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have
• OMIM: 604225

Protein Summary

• Protein general information: O15145  
  • Name: Actin related protein 2/3 complex subunit 3 (Arp2/3 complex 21 kDa subunit) (p21 ARC)
  • Length: 178  
  • Mass: 20547
• Sequence:

  MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYI
  SECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFD
  PQNDKPSKWWTCFVKRQFMNKSLSGPGQ

• Structural information:
  • Interpro: IPR007204  IPR036753  
  • DIP: 33187
  • STRING: ENSP00000228825
• Other Databases: GeneCards:  ARPC3  Malacards:  ARPC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005885	Arp2/3 protein complex	IBA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0051015	actin filament binding	IBA	contributes to
GO:0035861	site of double-strand break	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005885	Arp2/3 protein complex	TAS	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0051015	actin filament binding	IDA	contributes to
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0061850	growth cone leading edge	IEA	cellular component
GO:0031941	filamentous actin	IEA	cellular component
GO:0031252	cell leading edge	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070358	actin polymerization-dependent cell motility	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04666	Fc gamma R-mediated phagocytosis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
diabetes mellitus	PMID:26504501
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881