• Gene id: 10093

Gene Summary

• Gene Symbol: ARPC4   Gene   UCSC   Ensembl
• Aliases: ARC20, P20-ARC
• Gene name: actin related protein 2/3 complex subunit 4
• Alternate names: actin-related protein 2/3 complex subunit 4, actin related protein 2/3 complex, subunit 4, 20kDa, arp2/3 complex 20 kDa subunit, arp2/3 protein complex subunit p20,
• Gene location: 3p25.3 (9792494: 9807723)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes one of seven subunits of the human Arp2/3 protein complex. This complex controls actin polymerization in cells and has been conserved throughout eukaryotic evolution. This gene encodes the p20 subunit, which is necessary for actin nuclea
• OMIM: 606162

Protein Summary

• Protein general information: P59998  
  • Name: Actin related protein 2/3 complex subunit 4 (Arp2/3 complex 20 kDa subunit) (p20 ARC)
  • Length: 168  
  • Mass: 19667
• Sequence:

  MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSVRVSIA
  VKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMK
  LSVNARARIVAEEFLKNF

• Structural information:
  • Interpro: IPR034666  IPR008384  
  • DIP: 33188
  • STRING: ENSP00000388169
• Other Databases: GeneCards:  ARPC4  Malacards:  ARPC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035861	site of double-strand break	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030041	actin filament polymerization	IEA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051015	actin filament binding	IDA	contributes to
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005885	Arp2/3 protein complex	IDA	cellular component
GO:0051015	actin filament binding	NAS	contributes to
GO:0045010	actin nucleation	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030674	protein-macromolecule adaptor activity	IPI	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005885	Arp2/3 protein complex	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04666	Fc gamma R-mediated phagocytosis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Down syndrome	PMID:12054546
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881