• Gene id: 10090

Gene Summary

• Gene Symbol: UST   Gene   UCSC   Ensembl
• Aliases: 2OST
• Gene name: uronyl 2-sulfotransferase
• Alternate names: uronyl 2-sulfotransferase, dermatan/chondroitin sulfate 2-sulfotransferase,
• Gene location: 6q25.1 (148745890: 149076989)     Exons: 13     NC_000006.12
• Gene summary(Entrez): Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (Kobayashi et al., 1999 [PubMed 10187838]).[supplied by OMIM, Mar 2008]
• OMIM: 113995

Protein Summary

• Protein general information: Q9Y2C2  
  • Name: Uronyl 2 sulfotransferase (EC 2.8.2. )
  • Length: 406  
  • Mass: 47673
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFL
  LDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQM
  ELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEER
  YLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPH
  YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKRKFGLKSHVSKPPLRP
  HFFIPTPLETEEPIDDEEQDDEKWLEDIYKR

• Structural information:
  • Interpro: IPR007734  IPR027417  IPR005331  
  • STRING: ENSP00000356433
• Other Databases: GeneCards:  UST  Malacards:  UST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006477	protein sulfation	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray