• Gene id: 10089

Gene Summary

• Gene Symbol: KCNK7   Gene   UCSC   Ensembl
• Aliases: K2p7.1, TWIK3
• Gene name: potassium two pore domain channel subfamily K member 7
• Alternate names: potassium channel subfamily K member 7, potassium channel, subfamily K, member 7, potassium channel, two pore domain subfamily K, member 7, two pore domain K+ channel,
• Gene location: 11q13.1 (65595799: 65592835)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel; however, it may require other non-pore-forming proteins for activity
• OMIM: 604223

Protein Summary

• Protein general information: Q9Y2U2  
  • Name: Potassium channel subfamily K member 7
  • Length: 307  
  • Mass: 31947
• Sequence:

  MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQA
  HGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMVYAALGLPASLALVATLRHCLLPVLSR
  PRAWVAVHWQLSPARAALLQAVALGLLVASSFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRS
  LHPVIYHLGQLALLGYLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAPA
  SGQAPAC

• Structural information:
  • Interpro: IPR003280  IPR003092  IPR005408  IPR013099  
  • STRING: ENSP00000344820
• Other Databases: GeneCards:  KCNK7  Malacards:  KCNK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005267	potassium channel activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R