• Gene id: 10082

Gene Summary

• Gene Symbol: GPC6   Gene   UCSC   Ensembl
• Aliases: OMIMD1
• Gene name: glypican 6
• Alternate names: glypican-6, glypican proteoglycan 6,
• Gene location: 13q31.3-q32.1 (106774620: 106889315)     Exons: 17     NC_000012.12
• Gene summary(Entrez): The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor
• OMIM: 604404

Protein Summary

• Protein general information: Q9Y625  
  • Name: Glypican 6 [Cleaved into: Secreted glypican 6]
  • Length: 555  
  • Mass: 62736
  • Tissue specificity: Widely expressed. High expression in fetal kidney and lung and lower expressions in fetal liver and brain. In adult tissues, very abundant in ovary, high levels also observed in liver, kidney, small intestine and colon. Not detected in
• Sequence:

  MPSWIGAVILPLLGLLLSLPAGADVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKL
  SQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYY
  TGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGL
  TVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAE
  RLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTT
  AAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVD
  VDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRR
  EVDSSAAQRGHSLLSWSLTCIVLALQRLCR

• Structural information:
  • Interpro: IPR001863  IPR031183  IPR019803  
  • Prosite: PS01207
  • STRING: ENSP00000366246
• Other Databases: GeneCards:  GPC6  Malacards:  GPC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904929	coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway	NAS	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:1905475	regulation of protein localization to membrane	IBA	biological process
GO:1905606	regulation of presynapse assembly	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IBA	biological process
GO:0099560	synaptic membrane adhesion	IBA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Heparan sulfate proteoglycan gene defects	KEGG:H00493
Omodysplasia	KEGG:H02154
Heparan sulfate proteoglycan gene defects	KEGG:H00493
Omodysplasia	KEGG:H02154
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R