• Gene id: 1008

Gene Summary

• Gene Symbol: CDH10   Gene   UCSC   Ensembl
• Gene name: cadherin 10
• Alternate names: cadherin-10, T2-cadherin, cadherin 10 type 2,
• Gene location: 5p14.2-p14.1 (60421089: 60431425)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This gene encodes a type II classical cadherin of the cadherin superfamily. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the
• OMIM: 604555

Protein Summary

• Protein general information: Q9Y6N8  
  • Name: Cadherin 10 (T2 cadherin)
  • Length: 788  
  • Mass: 88451
  • Tissue specificity: Predominantly expressed in brain. Also found in adult and fetal kidney. Very low levels detected in prostate and fetal lung. {ECO
• Sequence:

  MTIHQFLLLFLFWVCLPHFCSPEIMFRRTPVPQQRILSSRVPRSDGKILHRQKRGWMWNQFFLLEEYTGSDYQYV
  GKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINRRTLRPVEPESEFVIKI
  HDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFSVEPETGIIRTALPNM
  NRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQNTIHLRVLESSPVGTAIGSVKATDADTGK
  NAEVEYRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRLYTLKVEAENTHVDPRFYYLGPFKDTTIVKISI
  EDVDEPPVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRFSLDRHTDLDRIFNIHSGNGSLYTSKPLDRE
  LSQWHNLTVIAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFF
  FSLAAVNPNFTVQDNEDNTARILTRKNGFNRHEISTYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSA
  EALLLPAGLSTGALIAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTL
  RNPAAIEEKKLRRDIIPETLFIPRRTPTAPDNTDVRDFINERLKEHDLDPTAPPYDSLATYAYEGNDSIAESLSS
  LESGTTEGDQNYDYLREWGPRFNKLAEMYGGGESDKDS

• Structural information:
  • Protein Domains: (55..16-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (161..26-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (270..38-)
    (/note="Cadherin-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR039808  IPR002126  IPR015919  IPR020894  IPR000233   IPR027397  
  • Prosite: PS00232 PS50268
  • STRING: ENSP00000264463
• Other Databases: GeneCards:  CDH10  Malacards:  CDH10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	IBA	biological process
GO:0045296	cadherin binding	IBA	molecular function
GO:0044331	cell-cell adhesion mediated by cadherin	IBA	biological process
GO:0034332	adherens junction organization	IBA	biological process
GO:0005912	adherens junction	IBA	cellular component
GO:0005509	calcium ion binding	IBA	molecular function
GO:0000902	cell morphogenesis	IBA	biological process
GO:0016342	catenin complex	IBA	cellular component
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007043	cell-cell junction assembly	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0099059	integral component of presynaptic active zone membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098609	cell-cell adhesion	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881