• Gene id: 10078

Gene Summary

• Gene Symbol: TSSC4   Gene   UCSC   Ensembl
• Gene name: tumor suppressing subtransferable candidate 4
• Alternate names: protein TSSC4, tumor-suppressing STF cDNA 4 protein, tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein,
• Gene location: 11p15.5 (2398411: 2403877)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms
• OMIM: 605008

Protein Summary

• Protein general information: Q9Y5U2  
  • Name: Protein TSSC4 (Tumor suppressing STF cDNA 4 protein) (Tumor suppressing subchromosomal transferable fragment candidate gene 4 protein)
  • Length: 329  
  • Mass: 34326
  • Tissue specificity: Expressed in fetal brain, lung, liver and kidney. Widely expressed in adult tissues. {ECO
• Sequence:

  MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPSGLLPA
  TVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNGGFKRPLAPSGRSPVEGLGRAHRSPASPRVP
  PVPDYVAHPERWTKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEAR
  HERKRVLGKVGEPGRGGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVE
  TVGFHGSRKRSRDHFRNKSSSPEDPGAEV

• Structural information:
  • Interpro: IPR029338  
  • STRING: ENSP00000331087
• Other Databases: GeneCards:  TSSC4  Malacards:  TSSC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq