• Gene id: 10077

Gene Summary

• Gene Symbol: TSPAN32   Gene   UCSC   Ensembl
• Aliases: ART1, PHEMX, PHMX, TSSC6
• Gene name: tetraspanin 32
• Alternate names: tetraspanin-32, pan-hematopoietic expression protein, protein Phemx, tumor-suppressing STF cDNA 6, tumor-suppressing subchromosomal transferable fragment cDNA 6, tumor-suppressing subtransferable candidate 6,
• Gene location: 11p15.5 (2299479: 2318203)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region ha

Protein Summary

• Protein general information: Q96QS1  
  • Name: Tetraspanin 32 (Tspan 32) (Protein Phemx)
  • Length: 320  
  • Mass: 34631
  • Tissue specificity: Expressed ubiquitously at low levels. High levels of expression are confined to hematopoietic tissues including peripheral blood leukocytes, thymus and spleen. {ECO
• Sequence:

  MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQWAFSAGLSLVGLLTLG
  AVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSHVRRQELAAIQ
  DVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRC
  GCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR
  ALQGRSRGGLSGCPERGLSD

• Structural information:
  • Interpro: IPR042782  IPR018499  IPR008952  
  • CDD: cd03153
  • STRING: ENSP00000182290
• Other Databases: GeneCards:  TSPAN32  Malacards:  TSPAN32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042832	defense response to protozoan	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0070527	platelet aggregation	IEA	biological process
GO:0070442	integrin alphaIIb-beta3 complex	IEA	cellular component
GO:0050688	regulation of defense response to virus	IEA	biological process
GO:0030886	negative regulation of myeloid dendritic cell activation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq