• Gene id: 10068

Gene Summary

• Gene Symbol: IL18BP   Gene   UCSC   Ensembl
• Aliases: FVH, IL18BPa
• Gene name: interleukin 18 binding protein
• Alternate names: interleukin-18-binding protein, MC51L-53L-54L homolog gene product, tadekinig-alfa,
• Gene location: 11q13.4 (71997943: 72002918)     Exons: 8     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune
• OMIM: 605958

Protein Summary

• Protein general information: O95998  
  • Name: Interleukin 18 binding protein (IL 18BP) (Tadekinig alfa)
  • Length: 194  
  • Mass: 21099
  • Tissue specificity: Strongly expressed in heart, lung, placenta and spleen. {ECO
• Sequence:

  MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVE
  VPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSC
  VLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

• Structural information:
  • Protein Domains: (65..16-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR039681  
  • Prosite: PS50835
  • STRING: ENSP00000384212
• Other Databases: GeneCards:  IL18BP  Malacards:  IL18BP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0042088	T-helper 1 type immune response	IBA	biological process
GO:0042007	interleukin-18 binding	IBA	molecular function
GO:0042007	interleukin-18 binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035655	interleukin-18-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:0042088	T-helper 1 type immune response	IDA	biological process
GO:0042007	interleukin-18 binding	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048019	receptor antagonist activity	TAS	molecular function

Diseases

Associated diseases	References
Cystic fibrosis	PMID:20026745
Allergic contact dermatitis	PMID:12874202
Chronic obstructive pulmonary disease	PMID:20026745
Myocardial infarction	PMID:19805173
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq