• Gene id: 10066

Gene Summary

• Gene Symbol: SCAMP2   Gene   UCSC   Ensembl
• Gene name: secretory carrier membrane protein 2
• Alternate names: secretory carrier-associated membrane protein 2, testis secretory sperm-binding protein Li 219p,
• Gene location: 15q24.1 (74873364: 74843729)     Exons: 11     NC_000015.10
• Gene summary(Entrez): This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes
• OMIM: 606912

Protein Summary

• Protein general information: O15127  
  • Name: Secretory carrier associated membrane protein 2 (Secretory carrier membrane protein 2)
  • Length: 329  
  • Mass: 36649
  • Tissue specificity: Widely expressed.
• Sequence:

  MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQ
  AVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICK
  MLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVF
  FCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQA
  QEEFSQGIFSSRTFHRAASSAAQGAFQGN

• Structural information:
  • Interpro: IPR007273  
  • STRING: ENSP00000268099
• Other Databases: GeneCards:  SCAMP2  Malacards:  SCAMP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0032588	trans-Golgi network membrane	IBA	cellular component
GO:0055038	recycling endosome membrane	IBA	cellular component
GO:0015031	protein transport	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006892	post-Golgi vesicle-mediated transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030133	transport vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0015031	protein transport	IDA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0032588	trans-Golgi network membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881