• Gene id: 10059

Gene Summary

• Gene Symbol: DNM1L   Gene   UCSC   Ensembl
• Aliases: DLP1, DRP1, DVLP, DYMPLE, EMPF, EMPF1, HDYNIV, OPA5
• Gene name: dynamin 1 like
• Alternate names: dynamin-1-like protein, Dnm1p/Vps1p-like protein, dynamin family member proline-rich carboxyl-terminal domain less, dynamin-like protein 4, dynamin-like protein IV, dynamin-related protein 1,
• Gene location: 12p11.21 (32679199: 32745649)     Exons: 21     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated i
• OMIM: 603850

Protein Summary

• Protein general information: O00429  
  • Name: Dynamin 1 like protein (EC 3.6.5.5) (Dnm1p/Vps1p like protein) (DVLP) (Dynamin family member proline rich carboxyl terminal domain less) (Dymple) (Dynamin like protein) (Dynamin like protein 4) (Dynamin like protein IV) (HdynIV) (Dynamin related protein 1
  • Length: 736  
  • Mass: 81,877
• Sequence:

  MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDK
  RKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGM
  TKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTD
  AMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
  LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFG
  RTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYS
  TQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELP
  SAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEE
  LLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLV
  NHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW

• Structural information:
  • Protein Domains: Dynamin-type (22-302)
    GED. (644-735)
  • Interpro: IPR030556  IPR000375  IPR001401  IPR019762  IPR022812   IPR030381  IPR003130  IPR020850  IPR027417  IPR011993  
  • Prosite: PS00410 PS51718 PS51388
  • CDD: cd08771
  • PDB: 3W6N 3W6O 3W6P 4BEJ 4H1U 4H1V
  • PDBsum: 3W6N 3W6O 3W6P 4BEJ 4H1U 4H1V
  • DIP: 42704
  • STRING: ENSP00000450399
• Other Databases: GeneCards:  DNM1L  Malacards:  DNM1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000266	mitochondrial fission	IMP	biological process
GO:0000266	mitochondrial fission	IDA	biological process
GO:0000266	mitochondrial fission	IMP	biological process
GO:0001836	release of cytochrome c from mitochondria	IMP	biological process
GO:0003374	dynamin family protein polymerization involved in mitochondrial fission	IDA	biological process
GO:0003374	dynamin family protein polymerization involved in mitochondrial fission	IDA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IMP	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016559	peroxisome fission	IDA	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032459	regulation of protein oligomerization	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IDA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0060047	heart contraction	IEA	biological process
GO:0061025	membrane fusion	IDA	biological process
GO:0070266	necroptotic process	IMP	biological process
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0070585	protein localization to mitochondrion	IEA	biological process
GO:0090141	positive regulation of mitochondrial fission	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	TAS	biological process
GO:0090149	mitochondrial membrane fission	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:1900063	regulation of peroxisome organization	IMP	biological process
GO:1903146	regulation of mitophagy	IGI	biological process
GO:1903578	regulation of ATP metabolic process	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000266	mitochondrial fission	IEA	biological process
GO:0000266	mitochondrial fission	IMP	biological process
GO:0000266	mitochondrial fission	IDA	biological process
GO:0000266	mitochondrial fission	IMP	biological process
GO:0001836	release of cytochrome c from mitochondria	IMP	biological process
GO:0003374	dynamin family protein polymerization involved in mitochondrial fission	IDA	biological process
GO:0003374	dynamin family protein polymerization involved in mitochondrial fission	IDA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IMP	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0012501	programmed cell death	IEA	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016559	peroxisome fission	IEA	biological process
GO:0016559	peroxisome fission	IDA	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032459	regulation of protein oligomerization	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0045202	synapse	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IDA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0060047	heart contraction	IEA	biological process
GO:0061025	membrane fusion	IDA	biological process
GO:0070266	necroptotic process	IMP	biological process
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0070585	protein localization to mitochondrion	IEA	biological process
GO:0090141	positive regulation of mitochondrial fission	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	TAS	biological process
GO:0090149	mitochondrial membrane fission	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:1900063	regulation of peroxisome organization	IMP	biological process
GO:1903146	regulation of mitophagy	IGI	biological process
GO:1903578	regulation of ATP metabolic process	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0000266	mitochondrial fission	IMP	biological process
GO:0000266	mitochondrial fission	IDA	biological process
GO:0000266	mitochondrial fission	IMP	biological process
GO:0001836	release of cytochrome c from mitochondria	IMP	biological process
GO:0003374	dynamin family protein polymerization involved in mitochondrial fission	IDA	biological process
GO:0003374	dynamin family protein polymerization involved in mitochondrial fission	IDA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IMP	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016559	peroxisome fission	IDA	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0016559	peroxisome fission	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032459	regulation of protein oligomerization	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IDA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0061025	membrane fusion	IDA	biological process
GO:0070266	necroptotic process	IMP	biological process
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	TAS	biological process
GO:0090149	mitochondrial membrane fission	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:1900063	regulation of peroxisome organization	IMP	biological process
GO:1903146	regulation of mitophagy	IGI	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04217	Necroptosis
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Poor sperm motility	MIK: 25118297
Male factor infertility	MIK: 25118297
Encephalopathy	OMIM: 603850
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Poor sperm motility	MIK: 25118297
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25118297	Poor sperm motility				Male infertility	DRP1 RanGAP1 Topoisomerase Ii? SUMO1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq