• Gene id: 10056

Gene Summary

• Gene Symbol: FARSB   Gene   UCSC   Ensembl
• Aliases: FARSLB, FRSB, HSPC173, NEDBLLA, PheHB, PheRS, RILDBC
• Gene name: phenylalanyl-tRNA synthetase subunit beta
• Alternate names: phenylalanine--tRNA ligase beta subunit, phenylalanine tRNA ligase 1, beta, cytoplasmic, phenylalanine-tRNA ligase beta chain, phenylalanine-tRNA synthetase-like, beta subunit, phenylalanyl-tRNA synthetase beta chain, phenylalanyl-tRNA synthetase beta subunit, ,
• Gene location: 2q36.1 (222656091: 222566898)     Exons: 19     NC_000002.12
• Gene summary(Entrez): This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer
• OMIM: 609690

Protein Summary

• Protein general information: Q9NSD9  
  • Name: Phenylalanine tRNA ligase beta subunit (EC 6.1.1.20) (Phenylalanyl tRNA synthetase beta subunit) (PheRS)
  • Length: 589  
  • Mass: 66116
• Sequence:

  MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANRYDLL
  CLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFIELQEKLHQNI
  CRKRALVAIGTHDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIENKPLYPVIYD
  SNGVVLSMPPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFP
  ELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYN
  NIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGVDISATKAVHISNPKTAEFQVA
  RTTLLPGLLKTIAANRKMPLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVP
  PGEDKGGYVIKASEGPAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINVGPFL

• Structural information:
  • Protein Domains: (302..37-)
    (/note="B5-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00816"-)
  • Interpro: IPR005146  IPR009061  IPR004531  IPR020825  IPR041616   IPR040659  IPR005147  
  • Prosite: PS51483
  • CDD: cd00769
  • PDB: 3L4G
  • PDBsum: 3L4G
  • DIP: 32869
  • STRING: ENSP00000281828
• Other Databases: GeneCards:  FARSB  Malacards:  FARSB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006432	phenylalanyl-tRNA aminoacylation	IBA	biological process
GO:0009328	phenylalanine-tRNA ligase complex	IBA	cellular component
GO:0009328	phenylalanine-tRNA ligase complex	IDA	cellular component
GO:0004826	phenylalanine-tRNA ligase activity	IDA	molecular function
GO:0006432	phenylalanyl-tRNA aminoacylation	IDA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004826	phenylalanine-tRNA ligase activity	IEA	molecular function
GO:0006432	phenylalanyl-tRNA aminoacylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004826	phenylalanine-tRNA ligase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006412	translation	TAS	biological process
GO:0004826	phenylalanine-tRNA ligase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray