Search Result
Gene id | 100533106 | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Diseases PubMed | |||||||||||||||||
Gene Summary |
|||||||||||||||||
Gene Symbol | ZHX1-C8orf76 Gene UCSC Ensembl | ||||||||||||||||
Gene name | ZHX1-C8orf76 readthrough | ||||||||||||||||
Alternate names | zinc fingers and homeoboxes protein 1, isoform 2, ZHX1-C8orf76 readthrough transcript protein, | ||||||||||||||||
Gene location |
8q24.13 (123274285: 123226190) Exons: 6 NC_000008.11 |
||||||||||||||||
Gene summary(Entrez) |
This locus represents naturally occurring read-through transcription between the neighboring zinc fingers and homeoboxes 1 (ZHX1) and chromosome 8 open reading frame 76 (C8orf76) genes. The read-through transcript encodes a protein that shares sequence id |
||||||||||||||||
OMIM | 0 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
Protein general information | Q96EF9 Name: Zinc fingers and homeoboxes protein 1, isoform 2 (ZHX1 C8orf76 readthrough transcript protein) Length: 292 Mass: 33285 | ||||||||||||||||
Sequence |
MLRKLWQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLG RHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALS AALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVL IETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVSVSLGFM | ||||||||||||||||
Structural information |
| ||||||||||||||||
Other Databases | GeneCards: ZHX1-C8orf76  Malacards: ZHX1-C8orf76 | ||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||
| |||||||||||||||||
PubMed references
|
|||||||||||||||||
|