• Gene id: 100507055

Gene Summary

• Gene Symbol: LRCOL1   Gene   UCSC   Ensembl
• Gene name: leucine rich colipase like 1
• Alternate names: leucine-rich colipase-like protein 1,
• Gene location: 12q24.33 (132610581: 132603150)     Exons: 7     NC_000012.12

Protein Summary

• Protein general information: A6NCL2  
  • Name: Leucine rich colipase like protein 1
  • Length: 159  
  • Mass: 17834
• Sequence:

  MAGPGWTLLLLLLLLLLLGSMAGYGPQKKLNLSHKGIGEPCRRHEECQSNCCTINSLAPHTLCTPKTIFLQCLPW
  RKPNGYRCSHDSECQSSCCVRNNSPQELCTPQSVFLQCVPWRKPNGDFCSSHQECHSQCCIQLREYSPFRCIPRT
  GILAQCLPL

• Structural information:
  • Interpro: IPR001981  
  • STRING: ENSP00000479730
• Other Databases: GeneCards:  LRCOL1  Malacards:  LRCOL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032094	response to food	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007586	digestion	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray