• Gene id: 100507027

Gene Summary

• Gene Symbol: MRLN   Gene   UCSC   Ensembl
• Aliases: LINC00948, Linc-RAM, M1, MLN, MUSER1
• Gene name: myoregulin
• Alternate names: myoregulin, Linc-RNA activator of myogenesis, long intergenic non-protein coding RNA 948, muscle enriched RNA 1, muscle specific 1,
• Gene location: 10q21.2 (59753454: 59736691)     Exons: 4     NC_000010.11
• Gene summary(Entrez): This gene encodes a small peptide that shares structural similarity to the small peptides sarcolipin and phospholamban, which are key regulators of sarcoplasmic reticulum Ca(2+)-ATPases (SERCAs). This protein is thought to have a similar function to these
• OMIM: 616246

Protein Summary

• Protein general information: P0DMT0  
  • Name: Myoregulin
  • Length: 46  
  • Mass: 5194
• Sequence:

  MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS

• Other Databases: GeneCards:  MRLN  Malacards:  MRLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004857	enzyme inhibitor activity	ISS	molecular function
GO:0033017	sarcoplasmic reticulum membrane	ISS	cellular component
GO:1902081	negative regulation of calcium ion import into sarcoplasmic reticulum	ISS	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0043086	negative regulation of catalytic activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)