• Gene id: 10043

Gene Summary

• Gene Symbol: TOM1   Gene   UCSC   Ensembl
• Gene name: target of myb1 membrane trafficking protein
• Alternate names: target of Myb protein 1, target of myb 1,
• Gene location: 22q12.3 (59399661: 59523554)     Exons: 14     NC_000015.10
• Gene summary(Entrez): This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. S
• OMIM: 604700

Protein Summary

• Protein general information: O60784  
  • Name: Target of Myb protein 1
  • Length: 492  
  • Mass: 53818
  • Tissue specificity: Widely expressed. Highly expressed in skeletal muscle, heart, placenta and liver. {ECO
• Sequence:

  MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLE
  TCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLE
  FPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELE
  MVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHER
  FERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGS
  SLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEER
  AKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL

• Structural information:
  • Protein Domains: (20..15-)
    (/note="VHS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00218-)
    (215..30-)
    (/note="GAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00373"-)
  • Interpro: IPR008942  IPR004152  IPR038425  IPR014645  IPR002014  
  • Prosite: PS50909 PS50179
  • PDB: 1ELK 1WRD 2N2N 2N9D 6J56
  • PDBsum: 1ELK 1WRD 2N2N 2N9D 6J56
  • DIP: 30844
  • STRING: ENSP00000413697
• Other Databases: GeneCards:  TOM1  Malacards:  TOM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0030276	clathrin binding	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016197	endosomal transport	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016197	endosomal transport	TAS	biological process
GO:0015031	protein transport	NAS	biological process
GO:0006897	endocytosis	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)