• Gene id: 100423062

Gene Summary

• Gene Symbol: IGLL5   Gene   UCSC   Ensembl
• Aliases: IGL, IGLV, VL-MAR
• Gene name: immunoglobulin lambda like polypeptide 5
• Alternate names: immunoglobulin lambda-like polypeptide 5, G lambda-1, anti HBs antibody light-chain Fab fragment, germline immunoglobulin lambda 1, immunoglobin anti-granzymeB light chain variable region, immunoglobulin lambda 1 light chain, immunoglobulin lambda 2 light chain,
• Gene location: 22q11.22 (22887815: 22896110)     Exons: 1     NC_000022.11
• Gene summary(Entrez): This gene encodes one of the immunoglobulin lambda-like polypeptides. It is located within the immunoglobulin lambda locus but it does not require somatic rearrangement for expression. The first exon of this gene is unrelated to immunoglobulin variable ge

Protein Summary

• Protein general information: B9A064  
  • Name: Immunoglobulin lambda like polypeptide 5 (G lambda 1) (Germline immunoglobulin lambda 1)
  • Length: 214  
  • Mass: 23063
  • Tissue specificity: Contrary to IGLL1, not expressed in pre-B-cells. {ECO
• Sequence:

  MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPS
  PQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
  KADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

• Structural information:
  • Protein Domains: (115..20-)
    (/note="Ig-like-C1-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003597  
  • Prosite: PS50835 PS00290
  • STRING: ENSP00000431254
• Other Databases: GeneCards:  IGLL5  Malacards:  IGLL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0006910	phagocytosis, recognition	IBA	biological process
GO:0050871	positive regulation of B cell activation	IBA	biological process
GO:0042742	defense response to bacterium	IBA	biological process
GO:0042571	immunoglobulin complex, circulating	IBA	cellular component
GO:0034987	immunoglobulin receptor binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0006958	complement activation, classical pathway	IBA	biological process
GO:0006911	phagocytosis, engulfment	IBA	biological process
GO:0003823	antigen binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)