• Gene id: 10036

Gene Summary

• Gene Symbol: CHAF1A   Gene   UCSC   Ensembl
• Aliases: CAF-1, CAF1, CAF1B, CAF1P150, P150
• Gene name: chromatin assembly factor 1 subunit A
• Alternate names: chromatin assembly factor 1 subunit A, CAF-1 subunit A, CAF-I 150 kDa subunit, CAF-I p150, CTB-50L17.7, chromatin assembly factor I (150 kDa), chromatin assembly factor I p150 subunit, hp150,
• Gene location: 19p13.3 (4402595: 4448321)     Exons: 18     NC_000019.10
• Gene summary(Entrez): Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 20
• OMIM: 604721

Protein Summary

• Protein general information: Q13111  
  • Name: Chromatin assembly factor 1 subunit A (CAF 1 subunit A) (Chromatin assembly factor I p150 subunit) (CAF I 150 kDa subunit) (CAF I p150) (hp150)
  • Length: 956  
  • Mass: 106910
• Sequence:

  MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTL
  ENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEASPSREAINGQ
  REDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSW
  SEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDSVLSHSSLSSPSSTSSPEGPP
  APPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKLRAEREEKEKLKEEAKRAKEEAKKKK
  EEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLEEKRKKEEEKRLREEEKRIKAEKAEITRFFQ
  KPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHV
  STRNADIFNSDVVIVERGKGDGVPERRKFGRMKLLQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDS
  DEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKG
  KRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGS
  KVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVL
  QSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGF
  QADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS

• Structural information:
  • Interpro: IPR029105  IPR029091  IPR022043  
  • DIP: 31135
  • STRING: ENSP00000301280
• Other Databases: GeneCards:  CHAF1A  Malacards:  CHAF1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033186	CAF-1 complex	IBA	cellular component
GO:0006334	nucleosome assembly	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0033186	CAF-1 complex	IDA	cellular component
GO:0031497	chromatin assembly	IDA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003682	chromatin binding	TAS	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070087	chromo shadow domain binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0006335	DNA replication-dependent nucleosome assembly	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component

Diseases

Associated diseases	References
colon cancer	PMID:24845563
colon cancer	PMID:24845563
Malignant glioma	PMID:18048407
neuroblastoma	PMID:24335960
neuroblastoma	PMID:24335960
Systemic lupus erythematosus	PMID:24836587
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray