• Gene id: 1003

Gene Summary

• Gene Symbol: CDH5   Gene   UCSC   Ensembl
• Aliases: 7B4, CD144
• Gene name: cadherin 5
• Alternate names: cadherin-5, 7B4 antigen, VE-cadherin, cadherin 5, type 2 (vascular endothelium), cadherin 5, type 2, VE-cadherin (vascular epithelium), cd144 antigen, endothelial-specific cadherin, vascular endothelial cadherin,
• Gene location: 16q21 (66366656: 66404783)     Exons: 12     NC_000016.10
• Gene summary(Entrez): This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin
• OMIM: 614413

Protein Summary

• Protein general information: P33151  
  • Name: Cadherin 5 (7B4 antigen) (Vascular endothelial cadherin) (VE cadherin) (CD antigen CD144)
  • Length: 784  
  • Mass: 87528
  • Tissue specificity: Endothelial tissues and brain.
• Sequence:

  MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGKIKSSV
  SRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
  FTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEI
  VVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
  DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVIINITDVDEPPIFQQP
  FYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFRVTKKGDIYNEKELDREVYPWYNLTVEAKEL
  DSTGTPTGKESIVQVHIEVLDENDNAPEFAKPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFT
  LTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
  VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPR
  PALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDS
  SDSDVDYDFLNDWGPRFKMLAELYGSDPREELLY

• Structural information:
  • Protein Domains: (48..15-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (152..25-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (259..37-)
    (/note="Cadherin-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR039808  IPR002126  IPR015919  IPR020894  IPR000233   IPR027397  IPR030052  
  • Prosite: PS00232 PS50268
  • DIP: 41172
  • STRING: ENSP00000344115
• Other Databases: GeneCards:  CDH5  Malacards:  CDH5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0043114	regulation of vascular permeability	IDA	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005912	adherens junction	IDA	cellular component
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0070700	BMP receptor binding	IPI	molecular function
GO:0070700	BMP receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070051	fibrinogen binding	IMP	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0031115	negative regulation of microtubule polymerization	IDA	biological process
GO:0034332	adherens junction organization	IDA	biological process
GO:0001932	regulation of protein phosphorylation	IDA	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:2000352	negative regulation of endothelial cell apoptotic process	IMP	biological process
GO:0005912	adherens junction	IMP	cellular component
GO:0035307	positive regulation of protein dephosphorylation	IMP	biological process
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0043534	blood vessel endothelial cell migration	IMP	biological process
GO:1902396	protein localization to bicellular tight junction	IMP	biological process
GO:0030513	positive regulation of BMP signaling pathway	IMP	biological process
GO:0031334	positive regulation of protein-containing complex assembly	IMP	biological process
GO:0070830	bicellular tight junction assembly	IMP	biological process
GO:0007043	cell-cell junction assembly	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0016342	catenin complex	IBA	cellular component
GO:0000902	cell morphogenesis	IBA	biological process
GO:0001944	vasculature development	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005912	adherens junction	IBA	cellular component
GO:0005923	bicellular tight junction	IBA	cellular component
GO:0034332	adherens junction organization	IBA	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	IBA	biological process
GO:0045296	cadherin binding	IBA	molecular function
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	IBA	biological process
GO:2000114	regulation of establishment of cell polarity	IBA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:2000114	regulation of establishment of cell polarity	IMP	biological process
GO:0030054	cell junction	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001955	blood vessel maturation	IEA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000114	regulation of establishment of cell polarity	IEA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0001955	blood vessel maturation	IEA	biological process
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005911	cell-cell junction	IDA	cellular component
GO:0045766	positive regulation of angiogenesis	IGI	biological process
GO:0050728	negative regulation of inflammatory response	IGI	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005912	adherens junction	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0043184	vascular endothelial growth factor receptor 2 binding	IPI	molecular function
GO:0007043	cell-cell junction assembly	IMP	biological process
GO:1903142	positive regulation of establishment of endothelial barrier	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05418	Fluid shear stress and atherosclerosis
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Coronary artery disease	PMID:14695457
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq