• Gene id: 100289187

Gene Summary

• Gene Symbol: TMEM225B   Gene   UCSC   Ensembl
• Aliases: GS1-259H13.2
• Gene name: transmembrane protein 225B
• Alternate names: transmembrane protein 225B, transmembrane protein 225-like,
• Gene location: 7q22.1 (99572365: 99611044)     Exons: 12     NC_000007.14
• OMIM: 0

Protein Summary

• Protein general information: P0DP42  
  • Name: Transmembrane protein 225B
  • Length: 221  
  • Mass: 25027
• Sequence:

  MLTLEDKDMKGFSWAIVPALTSLGYLIILVVSIFPFWVRLTNEESHEVFFSGLFENCFNAKCWKPRPLSIYIILG
  RVFLLSAVFLAFVTTFIMMPFASEFFPRTWKQNFVLACISFFTGACAFLALVLHALEIKALRMKLGPLQFSVLWP
  YYVLGFGIFLFIVAGTICLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI

• Structural information:
  • Interpro: IPR033542  
• Other Databases: GeneCards:  TMEM225B  Malacards:  TMEM225B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010923	negative regulation of phosphatase activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)