• Gene id: 10026

Gene Summary

• Gene Symbol: PIGK   Gene   UCSC   Ensembl
• Aliases: GPI8, NEDHCAS
• Gene name: phosphatidylinositol glycan anchor biosynthesis class K
• Alternate names: GPI-anchor transamidase, GPI transamidase subunit, GPI8 homolog, PIG-K, phosphatidylinositol glycan, class K, phosphatidylinositol-glycan biosynthesis class K protein,
• Gene location: 1p31.1 (77219429: 77088988)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This pro

Protein Summary

• Protein general information: Q92643  
  • Name: GPI anchor transamidase (GPI transamidase) (EC 3. . . ) (GPI8 homolog) (hGPI8) (Phosphatidylinositol glycan biosynthesis class K protein) (PIG K)
  • Length: 395  
  • Mass: 45252
• Sequence:

  MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRL
  GIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIPPSTPRSKRLL
  SDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALAS
  SQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLI
  TDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLW
  ALIIMVFFKTYGIKHMKFIF

• Structural information:
  • Interpro: IPR028361  IPR001096  
  • STRING: ENSP00000359848
• Other Databases: GeneCards:  PIGK  Malacards:  PIGK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003923	GPI-anchor transamidase activity	IBA	molecular function
GO:0042765	GPI-anchor transamidase complex	IBA	cellular component
GO:0034394	protein localization to cell surface	IBA	biological process
GO:0016255	attachment of GPI anchor to protein	IBA	biological process
GO:0003923	GPI-anchor transamidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016255	attachment of GPI anchor to protein	IEA	biological process
GO:0042765	GPI-anchor transamidase complex	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006506	GPI anchor biosynthetic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016255	attachment of GPI anchor to protein	TAS	biological process
GO:0003923	GPI-anchor transamidase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006506	GPI anchor biosynthetic process	IEA	biological process
GO:0042765	GPI-anchor transamidase complex	IDA	cellular component
GO:0042765	GPI-anchor transamidase complex	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0042765	GPI-anchor transamidase complex	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003756	protein disulfide isomerase activity	TAS	molecular function
GO:0034235	GPI anchor binding	TAS	contributes to
GO:0003923	GPI-anchor transamidase activity	IMP	molecular function
GO:0016255	attachment of GPI anchor to protein	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00563	Glycosylphosphatidylinositol

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881