• Gene id: 10025

Gene Summary

• Gene Symbol: MED16   Gene   UCSC   Ensembl
• Aliases: DRIP92, THRAP5, TRAP95
• Gene name: mediator complex subunit 16
• Alternate names: mediator of RNA polymerase II transcription subunit 16, thyroid hormone receptor-associated protein 5, thyroid hormone receptor-associated protein complex 95 kDa component, thyroid hormone receptor-associated protein, 95-kD subunit, vitamin D3 receptor-intera,
• Gene location: 19p13.3 (893227: 867960)     Exons: 16     NC_000019.10
• OMIM: 602566

Protein Summary

• Protein general information: Q9Y2X0  
  • Name: Mediator of RNA polymerase II transcription subunit 16 (Mediator complex subunit 16) (Thyroid hormone receptor associated protein 5) (Thyroid hormone receptor associated protein complex 95 kDa component) (Trap95) (Vitamin D3 receptor interacting protein c
  • Length: 877  
  • Mass: 96793
• Sequence:

  MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHS
  IPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSLVEGDPIVALSWLHNGVKLALHVEKS
  GASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGN
  IVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLARDMSEQVLLCASS
  QTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQ
  FYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHG
  KLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTR
  ILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLK
  TEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPV
  YTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRL
  QFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIK
  NCLAVEGRGPDACVTSRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPEDRP

• Structural information:
  • Interpro: IPR021665  IPR011041  IPR015943  IPR001680  IPR017986   IPR036322  
  • Prosite: PS50082 PS50294
  • DIP: 31463
  • STRING: ENSP00000325612
• Other Databases: GeneCards:  MED16  Malacards:  MED16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0016592	mediator complex	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0016592	mediator complex	IDA	cellular component
GO:0046966	thyroid hormone receptor binding	IDA	molecular function
GO:0030375	thyroid hormone receptor coactivator activity	IDA	molecular function
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0042809	vitamin D receptor binding	NAS	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	NAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0016592	mediator complex	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0016592	mediator complex	IDA	cellular component
GO:0046966	thyroid hormone receptor binding	IDA	molecular function
GO:0030375	thyroid hormone receptor coactivator activity	IDA	molecular function
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0042809	vitamin D receptor binding	NAS	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq