• Gene id: 100188893

Gene Summary

• Gene Symbol: TOMM6   Gene   UCSC   Ensembl
• Aliases: OBTP, TOM6
• Gene name: translocase of outer mitochondrial membrane 6
• Alternate names: mitochondrial import receptor subunit TOM6 homolog, over-expressed breast tumor protein, overexpressed breast tumor protein, translocase of outer membrane 6 kDa subunit homolog, translocase of outer mitochondrial membrane 6 homolog,
• Gene location: 6p21.1 (41787442: 41789895)     Exons: 3     NC_000006.12
• OMIM: 616168

Protein Summary

• Protein general information: Q96B49  
  • Name: Mitochondrial import receptor subunit TOM6 homolog (Overexpressed breast tumor protein) (Translocase of outer membrane 6 kDa subunit homolog)
  • Length: 74  
  • Mass: 8002
• Sequence:

  MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV

• Structural information:
  • Interpro: IPR029182  
  • STRING: ENSP00000381859
• Other Databases: GeneCards:  TOMM6  Malacards:  TOMM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005742	mitochondrial outer membrane translocase complex	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)