• Gene id: 10018

Gene Summary

• Gene Symbol: BCL2L11   Gene   UCSC   Ensembl
• Aliases: BAM, BIM, BOD
• Gene name: BCL2 like 11
• Alternate names: bcl-2-like protein 11, BCL2-like 11 (apoptosis facilitator), bcl-2 interacting mediator of cell death, bcl-2 interacting protein Bim, bcl-2-related ovarian death agonist,
• Gene location: 2q13 (111120913: 111168444)     Exons: 14     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene
• OMIM: 603827

Protein Summary

• Protein general information: O43521  
  • Name: Bcl 2 like protein 11 (Bcl2 L 11) (Bcl2 interacting mediator of cell death)
  • Length: 198  
  • Mass: 22171
  • Tissue specificity: Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in sple
• Sequence:

  MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT
  RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
  ELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

• Structural information:
  • Interpro: IPR014771  IPR017288  IPR015040  
  • PDB: 1F95 2K7W 2NL9 2V6Q 2VM6 2WH6 2YQ6 2YQ7 3D7V 3FDL 3IO8 3IO9 3KJ0 3KJ1 3KJ2 4A1U 4A1W 4B4S 4D2M 4QVF 4UF3 4YJ4 4ZIE 4ZIF 4ZIH 5AGW 5AGX 5C3G 5VWV 5VWW 5VWX 5VWY 5VWZ 5VX0 5VX2 5VX3 5WOS 6QFI 6RJP
  • PDBsum: 1F95 2K7W 2NL9 2V6Q 2VM6 2WH6 2YQ6 2YQ7 3D7V 3FDL 3IO8 3IO9 3KJ0 3KJ1 3KJ2 4A1U 4A1W 4B4S 4D2M 4QVF 4UF3 4YJ4 4ZIE 4ZIF 4ZIH 5AGW 5AGX 5C3G 5VWV 5VWW 5VWX 5VWY 5VWZ 5VX0 5VX2 5VX3 5WOS 6QFI 6RJP
  • DIP: 29185
  • STRING: ENSP00000376943
• Other Databases: GeneCards:  BCL2L11  Malacards:  BCL2L11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0071385	cellular response to glucocorticoid stimulus	TAS	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:1902237	positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	TAS	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0007127	meiosis I	IBA	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IDA	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904646	cellular response to amyloid-beta	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0034263	positive regulation of autophagy in response to ER overload	IEA	biological process
GO:1902263	apoptotic process involved in embryonic digit morphogenesis	IEA	biological process
GO:0097136	Bcl-2 family protein complex	IEA	cellular component
GO:0048538	thymus development	IEA	biological process
GO:0048070	regulation of developmental pigmentation	IEA	biological process
GO:0048066	developmental pigmentation	IEA	biological process
GO:0046620	regulation of organ growth	IEA	biological process
GO:0045787	positive regulation of cell cycle	IEA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043029	T cell homeostasis	IEA	biological process
GO:0035148	tube formation	IEA	biological process
GO:0019898	extrinsic component of membrane	IEA	cellular component
GO:0009791	post-embryonic development	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0002260	lymphocyte homeostasis	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:1902110	positive regulation of mitochondrial membrane permeability involved in apoptotic process	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0070242	thymocyte apoptotic process	IEA	biological process
GO:0060139	positive regulation of apoptotic process by virus	IEA	biological process
GO:0048563	post-embryonic animal organ morphogenesis	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0043583	ear development	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001782	B cell homeostasis	IEA	biological process
GO:0001776	leukocyte homeostasis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IGI	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:2000271	positive regulation of fibroblast apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0031334	positive regulation of protein-containing complex assembly	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05206	MicroRNAs in cancer
hsa05169	Epstein-Barr virus infection
hsa04932	Non-alcoholic fatty liver disease
hsa04210	Apoptosis
hsa04068	FoxO signaling pathway
hsa05210	Colorectal cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04215	Apoptosis - multiple species

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)