• Gene id: 10017

Gene Summary

• Gene Symbol: BCL2L10   Gene   UCSC   Ensembl
• Aliases: BCL-B, Boo, Diva, bcl2-L-10
• Gene name: BCL2 like 10
• Alternate names: bcl-2-like protein 10, BCL2-like 10 (apoptosis facilitator), anti-apoptotic protein NrH, apoptosis regulator Bcl-B, death inducer binding to vBcl-2 and Apaf-1,
• Gene location: 15q21.2 (52112774: 52109262)     Exons: 2     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene
• OMIM: 610221

Protein Summary

• Protein general information: Q9HD36  
  • Name: Bcl 2 like protein 10 (Bcl2 L 10) (Anti apoptotic protein NrH) (Apoptosis regulator Bcl B)
  • Length: 204  
  • Mass: 23204
  • Tissue specificity: Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney. {ECO
• Sequence:

  MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRF
  ELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM
  GQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL

• Structural information:
  • Interpro: IPR002475  IPR020717  IPR020726  IPR036834  IPR026298  
  • Prosite: PS50062 PS01080 PS01258
  • PDB: 4B4S
  • PDBsum: 4B4S
  • STRING: ENSP00000260442
• Other Databases: GeneCards:  BCL2L10  Malacards:  BCL2L10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0089720	caspase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IBA	biological process
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0046982	protein heterodimerization activity	IBA	molecular function
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007292	female gamete generation	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component

Diseases

Associated diseases	References
Myelodysplastic syndrome	PMID:21760590
Breast carcinoma	PMID:22207111
stomach carcinoma	PMID:21171085
stomach carcinoma	PMID:21171085
multiple myeloma	PMID:27455953
multiple myeloma	PMID:27455953
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881