• Gene id: 10014

Gene Summary

• Gene Symbol: HDAC5   Gene   UCSC   Ensembl
• Aliases: HD5, NY-CO-9
• Gene name: histone deacetylase 5
• Alternate names: histone deacetylase 5, antigen NY-CO-9,
• Gene location: 17q21.31 (44123650: 44076752)     Exons: 30     NC_000017.11
• Gene summary(Entrez): Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b
• OMIM: 605206

Protein Summary

• Protein general information: Q9UQL6  
  • Name: Histone deacetylase 5 (HD5) (EC 3.5.1.98) (Antigen NY CO 9)
  • Length: 1122  
  • Mass: 121978
  • Tissue specificity: Ubiquitous.
• Sequence:

  MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDPTLREQQ
  LQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKQQQEMLAAKRQQELEQQRQREQQ
  RQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSS
  PPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
  TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLG
  LQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLL
  LEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQK
  QQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
  CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQ
  PVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTL
  LYGTSPLNRQKLDSKKLLGPISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFA
  IIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
  FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGG
  YSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEKV
  IEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL

• Structural information:
  • Interpro: IPR000286  IPR023801  IPR037138  IPR024643  IPR017320   IPR030703  IPR023696  
  • PDB: 5UWI
  • PDBsum: 5UWI
  • DIP: 38260
  • STRING: ENSP00000225983
• Other Databases: GeneCards:  HDAC5  Malacards:  HDAC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0010830	regulation of myotube differentiation	ISS	biological process
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0040029	regulation of gene expression, epigenetic	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000118	histone deacetylase complex	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0040029	regulation of gene expression, epigenetic	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016575	histone deacetylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0006338	chromatin remodeling	TAS	biological process
GO:0006342	chromatin silencing	TAS	biological process
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0010832	negative regulation of myotube differentiation	IMP	biological process
GO:0010832	negative regulation of myotube differentiation	IMP	biological process
GO:0032869	cellular response to insulin stimulus	NAS	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016575	histone deacetylation	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0043393	regulation of protein binding	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	TAS	biological process
GO:0030183	B cell differentiation	TAS	biological process
GO:0006325	chromatin organization	TAS	biological process
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0042113	B cell activation	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006476	protein deacetylation	IMP	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0033558	protein deacetylase activity	IMP	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:2000615	regulation of histone H3-K9 acetylation	IMP	NOT|biological process
GO:0042826	histone deacetylase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa04371	Apelin signaling pathway

Diseases

Associated diseases	References
Pulmonary hypertension	PMID:22711276
colorectal cancer	PMID:23724067
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq