• Gene id: 100131187

Gene Summary

• Gene Symbol: TSTD1   Gene   UCSC   Ensembl
• Aliases: KAT, TST
• Gene name: thiosulfate sulfurtransferase like domain containing 1
• Alternate names: thiosulfate:glutathione sulfurtransferase, putative thiosulfate sulfurtransferase KAT, thiosulfate sulfurtransferase (rhodanese)-like domain containing 1, thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1,
• Gene location: 1q23.3 (161038963: 161037630)     Exons: 4     NC_000001.11
• OMIM: 616041

Protein Summary

• Protein general information: Q8NFU3  
  • Name: Thiosulfate:glutathione sulfurtransferase (TST) (EC 2.8.1. )
  • Length: 115  
  • Mass: 12530
  • Tissue specificity: Highly expressed in kidney, liver and skeletal muscle. Lower levels of expression in heart, colon, thymus, spleen, placenta and lung. Weakly expressed in brain, small intestine and peripheral blood leukocytes. Expressed at high levels
• Sequence:

  MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHL
  VFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES

• Structural information:
  • Protein Domains: (17..11-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173"-)
  • Interpro: IPR001763  IPR036873  IPR042457  
  • Prosite: PS50206
  • PDB: 6BEV
  • PDBsum: 6BEV
  • STRING: ENSP00000388293
• Other Databases: GeneCards:  TSTD1  Malacards:  TSTD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0050337	thiosulfate-thiol sulfurtransferase activity	IEA	molecular function
GO:0070221	sulfide oxidation, using sulfide:quinone oxidoreductase	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0050337	thiosulfate-thiol sulfurtransferase activity	TAS	molecular function
GO:0070221	sulfide oxidation, using sulfide:quinone oxidoreductase	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)