• Gene id: 100131137

Gene Summary

• Gene Symbol: BSPH1   Gene   UCSC   Ensembl
• Aliases: BSP1, ELSPBP2
• Gene name: binder of sperm protein homolog 1
• Alternate names: binder of sperm protein homolog 1, binder of sperm 1, bovine seminal plasma protein homolog 1, bovine seminal plasma protein-like 1, epididymal sperm binding protein 2,
• Gene location: 19q13.33 (47992169: 47967257)     Exons: 7     NC_000019.10
• OMIM: 612213

Protein Summary

• Protein general information: Q075Z2  
  • Name: Binder of sperm protein homolog 1 (Bovine seminal plasma protein homolog 1) (Bovine seminal plasma protein like 1)
  • Length: 132  
  • Mass: 15,693
• Sequence:

  MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY
  EGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTKNFNKDRIWKYCE

• Structural information:
  • Protein Domains: Fibronectin (40-84)
    Fibronectin (85-132)
  • Interpro: IPR000562  IPR036943  IPR013806  
  • Prosite: PS00023 PS51092
  • CDD: cd00062
  • STRING: ENSP00000341762
• Other Databases: GeneCards:  BSPH1  Malacards:  BSPH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0007338	single fertilization	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0048240	sperm capacitation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007338	single fertilization	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0048240	sperm capacitation	IEA	biological process

Diseases

Associated diseases	References
Sperm function	MIK: 19091820
Male factor infertility	MIK: 19091820
Important for male infertility	MIK: 24435510
Plays a role in sperm function	MIK: 22539676
Sperm function	MIK: 19091820

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19091820	Sperm function, fertility				Male infertility
24435510	Important for male infertility				Male infertility
22539676	Plays a role in sperm function				Male infertility