• Gene id: 10013

Gene Summary

• Gene Symbol: HDAC6   Gene   UCSC   Ensembl
• Aliases: CPBHM, HD6, JM21, PPP1R90
• Gene name: histone deacetylase 6
• Alternate names: histone deacetylase 6, protein phosphatase 1, regulatory subunit 90, tubulin-lysine deacetylase HDAC6,
• Gene location: Xp11.23 (48801397: 48824981)     Exons: 32     NC_000023.11
• Gene summary(Entrez): Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b
• OMIM: 613510

Protein Summary

• Protein general information: Q9UBN7  
  • Name: Histone deacetylase 6 (HD6) (EC 3.5.1.98) (Tubulin lysine deacetylase HDAC6) (EC 3.5.1. )
  • Length: 1215  
  • Mass: 131419
• Sequence:

  MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMD
  LNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYI
  DLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGY
  CMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
  QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAG
  GKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNM
  EEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLT
  LTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
  GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYD
  HGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLG
  GCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQ
  VHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
  AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGAT
  LGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLI
  GSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAA
  GLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
  IAHQNKFGEDMPHPH

• Structural information:
  • Interpro: IPR000286  IPR023801  IPR037138  IPR023696  IPR013083   IPR001607  
  • Prosite: PS50271
  • PDB: 3C5K 3GV4 3PHD 5B8D 5EDU 5KH3 5KH7 5KH9 5WBN 5WPB 6CE6 6CE8 6CEA 6CEC 6CED 6CEE 6CEF
  • PDBsum: 3C5K 3GV4 3PHD 5B8D 5EDU 5KH3 5KH7 5KH9 5WBN 5WPB 6CE6 6CE8 6CEA 6CEC 6CED 6CEE 6CEF
  • DIP: 27544
  • STRING: ENSP00000334061
• Other Databases: GeneCards:  HDAC6  Malacards:  HDAC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048156	tau protein binding	TAS	molecular function
GO:0048156	tau protein binding	ISS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0042903	tubulin deacetylase activity	TAS	molecular function
GO:0042903	tubulin deacetylase activity	IMP	molecular function
GO:0006476	protein deacetylation	TAS	biological process
GO:0016235	aggresome	TAS	cellular component
GO:0034983	peptidyl-lysine deacetylation	IMP	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0090042	tubulin deacetylation	TAS	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1903146	regulation of autophagy of mitochondrion	TAS	biological process
GO:0005771	multivesicular body	TAS	cellular component
GO:0010506	regulation of autophagy	TAS	biological process
GO:0061734	parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization	IGI	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0004407	histone deacetylase activity	IMP	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0090042	tubulin deacetylation	IDA	biological process
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0090042	tubulin deacetylation	IDA	biological process
GO:0106048	spermidine deacetylation	IDA	NOT|biological process
GO:0047611	acetylspermidine deacetylase activity	IDA	NOT|molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0106047	polyamine deacetylation	IDA	NOT|biological process
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0040029	regulation of gene expression, epigenetic	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090042	tubulin deacetylation	ISS	biological process
GO:0042903	tubulin deacetylase activity	ISS	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0008017	microtubule binding	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043204	perikaryon	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0051787	misfolded protein binding	EXP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042903	tubulin deacetylase activity	TAS	molecular function
GO:0060271	cilium assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization	IEA	biological process
GO:0090042	tubulin deacetylation	IEA	biological process
GO:0071218	cellular response to misfolded protein	IEA	biological process
GO:0070842	aggresome assembly	IEA	biological process
GO:0051646	mitochondrion localization	IEA	biological process
GO:0048156	tau protein binding	IEA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0042903	tubulin deacetylase activity	IEA	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0031648	protein destabilization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0006476	protein deacetylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0070846	Hsp90 deacetylation	IEA	biological process
GO:0070201	regulation of establishment of protein localization	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0048668	collateral sprouting	IEA	biological process
GO:0048487	beta-tubulin binding	IEA	molecular function
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA	biological process
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0034983	peptidyl-lysine deacetylation	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0032984	protein-containing complex disassembly	IEA	biological process
GO:0016575	histone deacetylation	IEA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0031593	polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0048156	tau protein binding	IDA	molecular function
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0070840	dynein complex binding	IDA	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0005901	caveola	IDA	cellular component
GO:0010727	negative regulation of hydrogen peroxide metabolic process	IC	biological process
GO:0016235	aggresome	IDA	cellular component
GO:0030286	dynein complex	IDA	colocalizes with
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051354	negative regulation of oxidoreductase activity	IC	biological process
GO:0060632	regulation of microtubule-based movement	IC	biological process
GO:0090042	tubulin deacetylation	IDA	biological process
GO:1901300	positive regulation of hydrogen peroxide-mediated programmed cell death	IDA	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0016241	regulation of macroautophagy	IMP	biological process
GO:0032418	lysosome localization	IMP	biological process
GO:0035967	cellular response to topologically incorrect protein	IMP	biological process
GO:0051788	response to misfolded protein	IMP	biological process
GO:0060765	regulation of androgen receptor signaling pathway	TAS	biological process
GO:0070842	aggresome assembly	IMP	biological process
GO:0070845	polyubiquitinated misfolded protein transport	IMP	biological process
GO:0005875	microtubule associated complex	IDA	cellular component
GO:0016234	inclusion body	IDA	cellular component
GO:0016575	histone deacetylation	IDA	biological process
GO:0031252	cell leading edge	IDA	cellular component
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	IMP	biological process
GO:0006886	intracellular protein transport	IMP	biological process
GO:0010870	positive regulation of receptor biosynthetic process	IMP	biological process
GO:0010870	positive regulation of receptor biosynthetic process	IMP	biological process
GO:0034983	peptidyl-lysine deacetylation	IMP	biological process
GO:0034983	peptidyl-lysine deacetylation	IMP	biological process
GO:0043242	negative regulation of protein-containing complex disassembly	IMP	biological process
GO:0045861	negative regulation of proteolysis	IMP	biological process
GO:0070301	cellular response to hydrogen peroxide	IMP	biological process
GO:0070848	response to growth factor	IMP	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0016575	histone deacetylation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0019899	enzyme binding	ISS	molecular function
GO:0048156	tau protein binding	TAS	molecular function
GO:0048156	tau protein binding	ISS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0042903	tubulin deacetylase activity	TAS	molecular function
GO:0042903	tubulin deacetylase activity	IMP	molecular function
GO:0006476	protein deacetylation	TAS	biological process
GO:0016235	aggresome	TAS	cellular component
GO:0034983	peptidyl-lysine deacetylation	IMP	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0090042	tubulin deacetylation	TAS	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1903146	regulation of autophagy of mitochondrion	TAS	biological process
GO:0005771	multivesicular body	TAS	cellular component
GO:0010506	regulation of autophagy	TAS	biological process
GO:0061734	parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization	IGI	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0004407	histone deacetylase activity	IMP	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0090042	tubulin deacetylation	IDA	biological process
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0090042	tubulin deacetylation	IDA	biological process
GO:0106048	spermidine deacetylation	IDA	NOT|biological process
GO:0047611	acetylspermidine deacetylase activity	IDA	NOT|molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0106047	polyamine deacetylation	IDA	NOT|biological process
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0040029	regulation of gene expression, epigenetic	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090042	tubulin deacetylation	ISS	biological process
GO:0042903	tubulin deacetylase activity	ISS	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0008017	microtubule binding	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043204	perikaryon	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0051787	misfolded protein binding	EXP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042903	tubulin deacetylase activity	TAS	molecular function
GO:0060271	cilium assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization	IEA	biological process
GO:0090042	tubulin deacetylation	IEA	biological process
GO:0071218	cellular response to misfolded protein	IEA	biological process
GO:0070842	aggresome assembly	IEA	biological process
GO:0051646	mitochondrion localization	IEA	biological process
GO:0048156	tau protein binding	IEA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0042903	tubulin deacetylase activity	IEA	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0031648	protein destabilization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0006476	protein deacetylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0070846	Hsp90 deacetylation	IEA	biological process
GO:0070201	regulation of establishment of protein localization	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0048668	collateral sprouting	IEA	biological process
GO:0048487	beta-tubulin binding	IEA	molecular function
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA	biological process
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0034983	peptidyl-lysine deacetylation	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0032984	protein-containing complex disassembly	IEA	biological process
GO:0016575	histone deacetylation	IEA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0031593	polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0048156	tau protein binding	IDA	molecular function
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0070840	dynein complex binding	IDA	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0005901	caveola	IDA	cellular component
GO:0010727	negative regulation of hydrogen peroxide metabolic process	IC	biological process
GO:0016235	aggresome	IDA	cellular component
GO:0030286	dynein complex	IDA	colocalizes with
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051354	negative regulation of oxidoreductase activity	IC	biological process
GO:0060632	regulation of microtubule-based movement	IC	biological process
GO:0090042	tubulin deacetylation	IDA	biological process
GO:1901300	positive regulation of hydrogen peroxide-mediated programmed cell death	IDA	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0016241	regulation of macroautophagy	IMP	biological process
GO:0032418	lysosome localization	IMP	biological process
GO:0035967	cellular response to topologically incorrect protein	IMP	biological process
GO:0051788	response to misfolded protein	IMP	biological process
GO:0060765	regulation of androgen receptor signaling pathway	TAS	biological process
GO:0070842	aggresome assembly	IMP	biological process
GO:0070845	polyubiquitinated misfolded protein transport	IMP	biological process
GO:0005875	microtubule associated complex	IDA	cellular component
GO:0016234	inclusion body	IDA	cellular component
GO:0016575	histone deacetylation	IDA	biological process
GO:0031252	cell leading edge	IDA	cellular component
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	IMP	biological process
GO:0006886	intracellular protein transport	IMP	biological process
GO:0010870	positive regulation of receptor biosynthetic process	IMP	biological process
GO:0010870	positive regulation of receptor biosynthetic process	IMP	biological process
GO:0034983	peptidyl-lysine deacetylation	IMP	biological process
GO:0034983	peptidyl-lysine deacetylation	IMP	biological process
GO:0043242	negative regulation of protein-containing complex disassembly	IMP	biological process
GO:0045861	negative regulation of proteolysis	IMP	biological process
GO:0070301	cellular response to hydrogen peroxide	IMP	biological process
GO:0070848	response to growth factor	IMP	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0016575	histone deacetylation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0019899	enzyme binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis

Diseases

Associated diseases	References
Chondrodysplasia Chassaing-Lacombe type	KEGG:H02260
Chondrodysplasia Chassaing-Lacombe type	KEGG:H02260
Polycystic liver disease	PMID:24434010
cholangiocarcinoma	PMID:23370327
cervix uteri carcinoma in situ	PMID:19147762
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881