• Gene id: 10011

Gene Summary

• Gene Symbol: SRA1   Gene   UCSC   Ensembl
• Aliases: SRA, SRAP, STRAA1, pp7684
• Gene name: steroid receptor RNA activator 1
• Alternate names: steroid receptor RNA activator 1, steroid receptor RNA activator 1 (complexes with NCOA1), steroid receptor RNA activator protein, steroid receptor coactivator,
• Gene location: 5q31.3 (140558092: 140550066)     Exons: 5     NC_000005.10
• Gene summary(Entrez): Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and
• OMIM: 603819

Protein Summary

• Protein general information: Q9HD15  
  • Name: Steroid receptor RNA activator 1 (Steroid receptor RNA activator protein) (SRAP)
  • Length: 236  
  • Mass: 25673
  • Tissue specificity: Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up-regulated in human tumors of the breast, ovary, and uterus. {EC
• Sequence:

  MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPM
  GPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAG
  GKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEK
  NHTIPGFQQAS

• Structural information:
  • Interpro: IPR009917  IPR040243  
  • PDB: 2MGX 4NBO
  • PDBsum: 2MGX 4NBO
  • STRING: ENSP00000337513
• Other Databases: GeneCards:  SRA1  Malacards:  SRA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0002153	steroid receptor RNA activator RNA binding	IDA	NOT|molecular function
GO:1990904	ribonucleoprotein complex	IDA	NOT|cellular component
GO:0002153	steroid receptor RNA activator RNA binding	IDA	NOT|molecular function
GO:0002153	steroid receptor RNA activator RNA binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IMP	NOT|biological process
GO:0045662	negative regulation of myoblast differentiation	IMP	biological process
GO:0071391	cellular response to estrogen stimulus	IMP	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0031252	cell leading edge	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0030154	cell differentiation	IDA	biological process
GO:0007346	regulation of mitotic cell cycle	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0031209	SCAR complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IPI	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)