• Gene id: 10008

Gene Summary

• Gene Symbol: KCNE3   Gene   UCSC   Ensembl
• Aliases: BRGDA6, HOKPP, HYPP, MiRP2
• Gene name: potassium voltage-gated channel subfamily E regulatory subunit 3
• Alternate names: potassium voltage-gated channel subfamily E member 3, cardiac voltage-gated potassium channel accessory subunit, minK-related peptide 2, minimum potassium ion channel-related peptide 2, potassium channel subunit beta MiRP2, potassium channel, voltage gated sub,
• Gene location: 11q13.4 (74467728: 74454840)     Exons: 6     NC_000011.10
• Gene summary(Entrez): Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
• OMIM: 138360

Protein Summary

• Protein general information: Q9Y6H6  
  • Name: Potassium voltage gated channel subfamily E member 3 (MinK related peptide 2) (Minimum potassium ion channel related peptide 2) (Potassium channel subunit beta MiRP2)
  • Length: 103  
  • Mass: 11710
  • Tissue specificity: Expressed in hippocampal neurons (at protein level) (PubMed
• Sequence:

  METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSL
  ILGYTRSRKVDKRSDPYHVYIKNRVSMI

• Structural information:
  • Interpro: IPR000369  IPR005426  
  • PDB: 2NDJ 6V00 6V01
  • PDBsum: 2NDJ 6V00 6V01
  • STRING: ENSP00000310557
• Other Databases: GeneCards:  KCNE3  Malacards:  KCNE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902282	voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IBA	contributes to
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IBA	biological process
GO:0097623	potassium ion export across plasma membrane	IBA	biological process
GO:0086011	membrane repolarization during action potential	IBA	biological process
GO:0086005	ventricular cardiac muscle cell action potential	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0005251	delayed rectifier potassium channel activity	IBA	contributes to
GO:0086091	regulation of heart rate by cardiac conduction	IBA	biological process
GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization	IBA	biological process
GO:0015459	potassium channel regulator activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	colocalizes with
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IDA	biological process
GO:0030425	dendrite	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0032809	neuronal cell body membrane	IDA	cellular component
GO:0043204	perikaryon	IDA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	colocalizes with
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IPI	colocalizes with
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0044325	ion channel binding	IEA	molecular function
GO:1901387	positive regulation of voltage-gated calcium channel activity	IEA	biological process
GO:1902260	negative regulation of delayed rectifier potassium channel activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0015459	potassium channel regulator activity	IEA	molecular function
GO:0043266	regulation of potassium ion transport	IEA	biological process
GO:1903817	negative regulation of voltage-gated potassium channel activity	IEA	biological process
GO:1905025	negative regulation of membrane repolarization during ventricular cardiac muscle cell action potential	IMP	biological process
GO:1903817	negative regulation of voltage-gated potassium channel activity	IDA	biological process
GO:1903765	negative regulation of potassium ion export across plasma membrane	IDA	biological process
GO:0086091	regulation of heart rate by cardiac conduction	IMP	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0098915	membrane repolarization during ventricular cardiac muscle cell action potential	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Brugada syndrome	KEGG:H00728
Periodic paralysis	KEGG:H00215
Brugada syndrome	KEGG:H00728
Periodic paralysis	KEGG:H00215
Hypokalemic periodic paralysis	PMID:11207363
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray