• Gene id: 10003

Gene Summary

• Gene Symbol: NAALAD2   Gene   UCSC   Ensembl
• Aliases: GCPIII, GPCIII, NAADALASE2, NAALADASE2
• Gene name: N-acetylated alpha-linked acidic dipeptidase 2
• Alternate names: N-acetylated-alpha-linked acidic dipeptidase 2, N-acetylated alpha-linked acidic dipeptidase II, NAALADase II, glutamate carboxypeptidase III,
• Gene location: 11q14.3 (15619703: 15565481)     Exons: 14     NC_000017.11
• Gene summary(Entrez): This gene is a member of the N-acetylated alpha-linked acidic dipeptidase (NAALADase) gene family. The representative member of this family is the gene encoding human prostate-specific membrane antigen (PSM), which is a marker of prostatic carcinomas and
• OMIM: 611636

Protein Summary

• Protein general information: Q9Y3Q0  
  • Name: N acetylated alpha linked acidic dipeptidase 2 (EC 3.4.17.21) (Glutamate carboxypeptidase III) (GCPIII) (N acetylated alpha linked acidic dipeptidase II) (NAALADase II)
  • Length: 740  
  • Mass: 83592
  • Tissue specificity: Highest expression in the testis. Also found in ovary and spleen. Weak expression in prostate, heart and placenta. In brain, expressed in striatum, parietal cortex and ventral striatum with lower levels in hippocampus, brain stem, puta
• Sequence:

  MAESRGRLYLWMCLAAALASFLMGFMVGWFIKPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRSFTKLPHLAG
  TEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPP
  YNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGKIVIARYGKIFRGNKVKNAMLAGAIGIILYSDPADYF
  APEVQPYPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLG
  GIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRGSVEPDRYVILGGHRDSWVFGA
  IDPTSGVAVLQEIARSFGKLMSKGWRPRRTIIFASWDAEEFGLLGSTEWAEENVKILQERSIAYINSDSSIEGNY
  TLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRA
  RYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAAS
  IYNLSKKHDQQLTDHGVSFDSLFSAVKNFSEAASDFHKRLIQVDLNNPIAVRMMNDQLMLLERAFIDPLGLPGKL
  FYRHIIFAPSSHNKYAGESFPGIYDAIFDIENKANSRLAWKEVKKHISIAAFTIQAAAGTLKEVL

• Structural information:
  • Interpro: IPR003137  IPR007484  IPR039373  IPR007365  IPR036757  
  • PDB: 3FEC 3FED 3FEE 3FF3
  • PDBsum: 3FEC 3FED 3FEE 3FF3
  • STRING: ENSP00000432481
• Other Databases: GeneCards:  NAALAD2  Malacards:  NAALAD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004180	carboxypeptidase activity	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0042135	neurotransmitter catabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050129	N-formylglutamate deformylase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0008239	dipeptidyl-peptidase activity	NAS	molecular function
GO:0008236	serine-type peptidase activity	NAS	molecular function
GO:0006508	proteolysis	NAS	biological process
GO:0004180	carboxypeptidase activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016805	dipeptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq